SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000004223 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000004223
Domain Number 1 Region: 881-1008,1040-1245
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.98e-77
Family p120GAP domain-like 0.00032
Further Details:      
 
Domain Number 2 Region: 33-197
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.09e-37
Family Calponin-homology domain, CH-domain 0.0000208
Further Details:      
 
Domain Number 3 Region: 1478-1575
Classification Level Classification E-value
Superfamily RGC domain-like 3.14e-34
Family RGC domain 0.00000407
Further Details:      
 
Domain Number 4 Region: 656-748
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000133
Family Motor proteins 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000004223   Gene: ENSTGUG00000004085   Transcript: ENSTGUT00000004268
Sequence length 1575
Comment pep:novel chromosome:taeGut3.2.4:Z:57030269:57155328:-1 gene:ENSTGUG00000004085 transcript:ENSTGUT00000004268 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHHEELASLQRPRYGSIVDDERLSAEEMDERRRQNIAYEYLCHLEEAKRWMEVCLDEELP
PTTELEEGLRNGVYLAKLAKFFAPNVVSDKKIYDVEQARYKRSGLHFRHTDNTVQWLRAM
ESIGLPKIFYPETTDVYDRKNIPRMIYCIHALSLYLFKLGLAPQIQDLLGKVDFTEEEIS
NMRKELEKYGIQMPSFSKIGGILASELSVDEAALHAAVIAINEAVEKGIAEQTIVTLRNP
NAMLLSVDEELAQDYQNELFDAKRKKQSNARLKNGTISDEERDVYEELLTQAEIQGNINK
INKLIAVDNINTAIRNCDPSKTLVALLKPEAQLPIVHSFAAAVYQTELFNLQQQNAVNYL
AHDELSIAVEMLSAVVLLNQTLENKDILMIKNHLRDPCLGFNNLEEENLQRYADTLLSIK
SEASSQGQDYLSWNDIQNCIDMVNMQIKEENERIIAIGHINEAVDQGDPEKTLEALLLPT
AKLQDVRPANARHYQDVLHHAKAQKCKESQDESALLWLDEIQRGINDSNNNIKEAATLAV
GISMINKSLEKGDSQPVPMILQSRFGLRVIAECAEAYFRNLSEAKNRKTTEGSSESPWIK
LVMKAMYDYYYNVETEEGTCVAPKGVVPKTSWLTSEEIQNIAGQVTADYNREQLWLANEN
LIVGLQARARGFLVRKNYQERKAYLQNQEPSAIKIQAFWKGFKQRKSYVDRLKVLQGNVA
AIVKIQSWVKMWLARRAYRNRLQYFKDHNDQIVKIQAFLRANKAREDYRTLIGAENPPLT
VLRKFAYLLDQSDLDFQEELEVTRLREEVVTKIRSNQQLEKDLNLMDIKIGLLVKNRITL
QDVVLHSKKLNKKSKSQLKEMVMVDKQGIKGLSKERRKKLEAYQHLFYLLQTNPTYLAKL
IFQMPQNKSTKFMDTVIFTLYNYASNQREEYLLLKLFKTALEEEITSKVDQIQDIVTGNP
TVIKMVVSFSRGARGQTTLRQLLGPVVKEIMEDKSLIINTSPVDVYKAWVNQLEMQTGEA
SKLPYDVTTEQALTHAEVVNKLESSIQSLRAVTDKVLTSIFSSLNMLPYGMRYIAKVLKS
SLHDKFPDATEDELLKVVGNLLYYRYMNPAIVAPDGFDIIDITAGGQIHPDQRRNLGCVA
KVLQHAASNKLFEGESEHLSSMNTYLSQTYQKFRNFFQAACDVPEPEEKFNIDEYSDMVT
LSKPVIYISIEEIINTHSLLLEHQDAIATETNDLLNELLEGLGPVPDIESFLGEGAVDPS
DPNRESTLSQLAKTEISLSLTCKYELREGEDQDLKSLMIKTKRLIVDVIRTQPGDTLSEI
LETPATAQQESENLKLVEKRAILDSKTPEKMKQNQSFFEDGQLPIEQKKRKIQRNLRTLE
QAGLVSSATKYQEIINEIAKDIRNQRRYRHHRKAELVKLQQTLNALNSKTAFYEEQINYY
NTYIKTCLDNLTRKNSRRSIKLDGKEEVKGSKKLKQTSLKYTAARLHEKGVILEIEDLQT
NQFKNVMFDITPGEEVGDFEIKAKFLGVEMEKVQLHFQDLLQMQYEGVAVMKMFDKAKVN
VNLLIFLLNKKFYGK
Download sequence
Identical sequences H0Z0Y6
ENSTGUP00000004223 59729.ENSTGUP00000004223 ENSTGUP00000004223 XP_004174296.1.42559

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]