SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000004331 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000004331
Domain Number 1 Region: 12-216
Classification Level Classification E-value
Superfamily PR-1-like 3.92e-54
Family PR-1-like 0.00013
Further Details:      
 
Domain Number 2 Region: 290-388
Classification Level Classification E-value
Superfamily LCCL domain 2.22e-30
Family LCCL domain 0.00084
Further Details:      
 
Domain Number 3 Region: 392-497
Classification Level Classification E-value
Superfamily LCCL domain 3.53e-27
Family LCCL domain 0.00099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000004331   Gene: ENSTGUG00000004192   Transcript: ENSTGUT00000004377
Sequence length 503
Comment pep:novel chromosome:taeGut3.2.4:11:809002:832625:-1 gene:ENSTGUG00000004192 transcript:ENSTGUT00000004377 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNPALPWIVPLGCVLLLTKTAECFILPNSSHLESILSKYQDGEAHSRSKRAILFSDRQEI
LMLHNKLRGQVYPVASNMEYMTWDEELERSAHAWAQQCIWDHGPSDLIRSIGQNLAVHWG
RYRSPAFHVQSWYDEVKDYTFPYPHECNPWCPERCTGAMCTHYTQIVWATTNRIGCAVHV
CKQMNVWGEIWENAVYLVCNYSPKGNWIGEAPYKTGRPCSECPPSYGGSCQNNLCYKDHR
YEDPILAETDETNEVEIPQVAEQKPVQFHLPENKPSKTIKPKKMTPESYMTQVITCETKM
RDKCRGSTCNRYLCPAGCLYSKGKVFGTFYYESSSSICRAAIHYGILDNKGGLVDITRRG
RTPAFVKSTRNGVESFRKSKPSNAFMVSKVTTQTLDCYTTVAELCHFKKPASHCPRIYCP
AHCKDEPSYWAPVFGTNVYADSSSICKTAVHAGVISDERGGFVDVMPVEKKKTYVGSLKN
GVQSESLKNPSDGNAFRIFAVKQ
Download sequence
Identical sequences H0Z193
59729.ENSTGUP00000004331 ENSTGUP00000004331 ENSTGUP00000004331 XP_002194276.1.42559

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]