SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000004388 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000004388
Domain Number 1 Region: 118-421,459-513,558-613
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.54e-68
Family Calponin-homology domain, CH-domain 0.0015
Further Details:      
 
Domain Number 2 Region: 866-965
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000584
Family Motor proteins 0.041
Further Details:      
 
Domain Number 3 Region: 599-730
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000195
Family Motor proteins 0.026
Further Details:      
 
Domain Number 4 Region: 1853-1929
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000146
Family Motor proteins 0.033
Further Details:      
 
Domain Number 5 Region: 1275-1350
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000319
Family Motor proteins 0.035
Further Details:      
 
Domain Number 6 Region: 1639-1711
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000504
Family Motor proteins 0.051
Further Details:      
 
Domain Number 7 Region: 1933-2006
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000173
Family Motor proteins 0.033
Further Details:      
 
Domain Number 8 Region: 1412-1490
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000183
Family Motor proteins 0.064
Further Details:      
 
Domain Number 9 Region: 1566-1638
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000478
Family Motor proteins 0.029
Further Details:      
 
Domain Number 10 Region: 964-1056
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000114
Family Motor proteins 0.03
Further Details:      
 
Domain Number 11 Region: 1496-1561
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000165
Family Motor proteins 0.054
Further Details:      
 
Domain Number 12 Region: 1128-1202
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000189
Family Motor proteins 0.04
Further Details:      
 
Domain Number 13 Region: 1058-1130
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000345
Family Motor proteins 0.036
Further Details:      
 
Domain Number 14 Region: 1789-1859
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000478
Family Motor proteins 0.035
Further Details:      
 
Domain Number 15 Region: 1206-1274
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000531
Family Motor proteins 0.044
Further Details:      
 
Domain Number 16 Region: 2005-2106
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000069
Family Motor proteins 0.03
Further Details:      
 
Domain Number 17 Region: 2183-2313
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000319
Family Motor proteins 0.04
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000004388
Domain Number - Region: 814-869
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000372
Family Motor proteins 0.064
Further Details:      
 
Domain Number - Region: 1715-1784
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000372
Family Motor proteins 0.049
Further Details:      
 
Domain Number - Region: 2363-2472
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00425
Family Motor proteins 0.014
Further Details:      
 
Domain Number - Region: 2597-2719
Classification Level Classification E-value
Superfamily ARM repeat 0.00691
Family Clathrin adaptor core protein 0.078
Further Details:      
 
Domain Number - Region: 2315-2367
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0125
Family Motor proteins 0.044
Further Details:      
 
Domain Number - Region: 2454-2518
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0127
Family Motor proteins 0.037
Further Details:      
 
Domain Number - Region: 2518-2566
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0292
Family Motor proteins 0.034
Further Details:      
 
Domain Number - Region: 733-814
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0319
Family Motor proteins 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000004388   Gene: ENSTGUG00000004249   Transcript: ENSTGUT00000004434
Sequence length 2794
Comment pep:novel chromosome:taeGut3.2.4:8:4404367:4426237:-1 gene:ENSTGUG00000004249 transcript:ENSTGUT00000004434 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TSKATKRISKPVPGLAQSHLTFVKPLKTVIPRHPMPFAAKNMFYDERWKEKQQRGFTWWL
NFVLTPDDFNVKTNTSQVNAAALILGEENHHKRSLPKAPTKDEASLKAYTARRKLNRLRR
QACRLFTSESMVRAIQKLEVEIETRRLLVRRDRHLWKDIGERQKILNWLLSYNPLWLRIG
LETIYGELIALESNSDVMGLAIFILNRLLWNPDIATEYRHPLVPHLYREGHEEALSKFTL
KKLLLLVCFLDCAKQSRMIDHDPCLFCKDAEFKASKDLLLAFSRDFLSGEGDLSRHLGFL
GLPVSHVQTPLDEFDFAVTNLAVDLQCGIRLVRTVELLTKNWNLSKQLRVPAISRLQKMH
NVEIVLNVLKERGVHLKDETGASIDSRDIVDRHRERTLALLWKIVFAFQVDVFLNVEHLK
EEIEFLKNTYRTKALLGASKTYPNYFRIQEDSSNISSQTYSENVKLLMAWVNAVCRFYNI
KVENFTVCFSDGRVLCHLIHHYHPCYMPLEAVCQRTTQTVECSRTVTVGLNSSSSSESDT
SLNVVEETFDQSESSFLYKELLDNEKQNFQLINAAVSNLGGIPAMIHHADMSNTIPDEKV
VITYLSFLCSRLLDLRQETRAARLIQAAWRKYRMKRELKLSQERDRAARIIQKSAMNFLA
RRRILRKEKAAIFIQKHWRGYLARMTLFNLKKAKLEEARNKSATVIQAYWRRYSARRRYL
QLRHCVIFVQARIRMVKSVAAYKQIVGATVTIQRHLRAAKLAKIDRQRYQILKSSALTIQ
SAFRRWRKYKIQQKIKAALVIQSYFRKWQSSKLAKRKRAALVIQSWYRMHRDLKQYLHVK
QSVIKIQAWYRCQLARHVYQKNRAKIVTIQQYYRAYKLAKGERECYLQKRAAVIVLQAAF
RGMKARELYRQARAACVIQSLWRMKREKQRFLQLKKSVTMLQSHVRRYQQVKRYKEIKNA
ASVIQTRYRAHVAAKKANAAFQRVRLAAIVLQSAYRGMQARRQACILRSVIKIQSSFRAY
VAQKRFKNLRDATVKIQALAKMRQVRKRYCALREAFKEDYRKLKRGCVRIQALVRGYLVR
KQIQRWREAAILLQACYRMKRDRRRYLSIYSAATVIQQRYRACKKTRCHRQEFLQVRKAA
VCLQAAYRGYKTRKKLKLECRAAIKIQTAFRAHAARVKHKAMVQVSIVIQRWYRNCKGGK
RQRLNFLMTRAAVLSLQAAFRGWRVRKQIQRQHVAATKIQSTFRKFMAVKKFRLVKHAVL
TIQRHYRATVLGQRQRQEYIHLRNAAVRLQALWRGKVVRRTIQKKHNLATIIQSYYRMHI
NQLKYKKLRQATLVIQKYYRAYCMKKTQRLIYLQIKAAVLVLQSAYRGMTVRRQLNKLNK
AATTIQAAFNLTWSRRYGRLRSAYSHQRRQYRAICLGQVQRKTYLELKKSVVILQAAYRG
MKVRQDLKTMHQSAAIIQSYYRMHKQQRNFRKLLLATRQIQQWFRACKERDAQVHKYMIM
KNAVLHIQAAFRGMKTRRLLRTMNVSAVIIQRRFRTFLERKHFLSIKSAAIVVQRKYRAT
KIANIQRQKYLSLLNAAVIIQSAYRGFVVRKKMQQMHQAATVIQAMLRMHKIYTSYQALR
LASVIIQQRYRAYREGKREREKYLKLCNSVLVLQAAYRGMKIRHFLKRQREAALTIQRNY
RMYRQYCHYRKVQWAAQLIQRRYRAHRLRKIAVEHYTSLKKAATCIQRAFRDMRVRKQQQ
EMHRAATVVQKNFKAFRERQRYLSLKAATLVFQRRYRALALARQHALEYHSLRRAAIHIQ
AVYRGVRVRRSLKHMHSAASTIQATYRMLRDRRAYQNMRIAAMLIQIYYRCYLKGKNQRK
KYLTMRNSILVIQAAYRGMRARQELKLLHVSAVVIQSSYRMYVQRRCYKQLCWAATVTQQ
RFRAKMAREAAMRNYAEIRKAVICLQAAFRARKARQRRFLRQKSAAIMIQSVFRCWRART
CYAQLRSSAVAVQSWYRGCLRARAQRAQKIQSFLQMALQRRRYIQLRAAAVTLQSYYLMH
KCKSLYMSYRRAAVVLQRHYRSHLIVKQQRMAYLQTRRNVVLVQATVRGYIERKRFHKMK
ASTIKIQYTQIRFFKTTSPLNNSGLMNVFFDENMSESSLHEKGTGSETHIQEGGKFPQIK
EEREIISHNIFKPVSTAVHRKMQIFLADMMQVVKYSKLSFSLKASFRGFLERQKYLLCKS
SAVLIQQHYRAHRMQNIDQHRFHQMKKAAITIQVIIKLFLQTNSKEQHLDRNPKNCSSYR
GYKARQWVNQMRAARAIQAWFPGHKAWKEYPLSVLRATLVIQSHLRAKQLRTRFLKMKSC
ALTIQRAWRATCAARRLRQQFLATRSHQAACLIQNTYRGFKTRRKFVQQKAAAVIIQKHL
RAWQEGRVQFVKYNKTRRAVIKLQAFIRGYLVRKKISEQKQKKRLLYFAAAAYHHISAIK
IQRAYRIHLTLKLAETQISSVLIIQSWFRAKIQRRRFLRDYQRVVVLQRALRGWLNRRSE
AATVIQRNARAFLARRRRRRLAVGIVKFQALWRGYSWRKMTDTAKTRALRRSLEKANEKS
REENKLGNRTAIAIDHLLKYKHLSYILAALKHLEVATRLSPLCCENMAQSRAIFSVFLLI
RSCNRSVPCMDVIRYSVQVLLNVSKYERTTRAVYEAENSIDTLLDLLQMYRGKAGDKVSE
KGGSIFTKTCCLLAILSKDSKRALEIRGMPRTVSCIQSLYKLTARKHRMDAERTLVKQKT
NTALGGSSSVPVTPLRIKTVSRIKPDWVLRKDNM
Download sequence
Identical sequences H0Z1F0
ENSTGUP00000004388 ENSTGUP00000004388 59729.ENSTGUP00000004388

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]