SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000004752 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000004752
Domain Number 1 Region: 26-181
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.44e-30
Family Calponin-homology domain, CH-domain 0.0025
Further Details:      
 
Domain Number 2 Region: 202-281
Classification Level Classification E-value
Superfamily GAS2 domain-like 6.54e-30
Family GAS2 domain 0.00000462
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000004752   Gene: ENSTGUG00000004608   Transcript: ENSTGUT00000004801
Sequence length 314
Comment pep:novel chromosome:taeGut3.2.4:5:710194:782885:1 gene:ENSTGUG00000004608 transcript:ENSTGUT00000004801 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCTALSPKARGPGLSDMHQYSQWLASRHEANLLPMKEDLALWLTNLLGREITAETFMEKL
DNGALLCRLAETLQEKFKENSFDANKPGKALPVRKIPCKANAPSGSFFARDNTANFLSWC
RDVGVDDTCLFESEGLVLHKQPREVCLCLLELGRIAARCGVEPPGLIKLEKEIEQEETLS
APLPSPSPSPTKSPGKKSTGKLLDDAVKHISEDPPCKCPNKFCVERLSQGRYRVGEKILF
IRMLHNKHVMVRVGGGWETFAGYLLKHDPCRMLQISRVDGKTSPIQSKSPNIRDMNPDNY
LVVSAHYKTKKEIK
Download sequence
Identical sequences H0Z2G0
ENSTGUP00000004752 59729.ENSTGUP00000004752 ENSTGUP00000004752 XP_012429185.1.42559

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]