SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000005378 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000005378
Domain Number 1 Region: 2-173
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.72e-54
Family G proteins 0.000000568
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000005378   Gene: ENSTGUG00000005228   Transcript: ENSTGUT00000005432
Sequence length 204
Comment pep:known chromosome:taeGut3.2.4:4A:16050745:16053813:1 gene:ENSTGUG00000005228 transcript:ENSTGUT00000005432 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RIFKIIVIGDSNVGKTCLTFRFCGGTFPGKTEATIGVDFREKTVEIEGERIKVQVWDTAG
QERFRKSMVEHYYRNVHAVVFVYDVTKMSSFTNLKTWIEECNGHAVPPLVPRVLVGNKCD
LKDLIQVPSSLALKFADAHNMLLFETSAKDPQESQNVDAIFMCLVCRLKAQRSLPCRDTE
GWPAQPQPQPRRLEEASGKGSCPC
Download sequence
Identical sequences H0Z484
59729.ENSTGUP00000005378 ENSTGUP00000005378 ENSTGUP00000005378

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]