SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000005549 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000005549
Domain Number 1 Region: 1083-1188,1250-1529
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 3.51e-50
Family Glycosyltransferase family 36 C-terminal domain 0.059
Further Details:      
 
Domain Number 2 Region: 120-253,457-665
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.84e-41
Family Amylase, catalytic domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000005549   Gene: ENSTGUG00000005336   Transcript: ENSTGUT00000005604
Sequence length 1530
Comment pep:novel chromosome:taeGut3.2.4:8:8300806:8332611:-1 gene:ENSTGUG00000005336 transcript:ENSTGUT00000005604 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGSKETRLLHLGEMEKLDKTLFRLEQGFELQFRLGPTLQGKPVTVYTNYPASGEVFDRH
KFRTLSWHNPTGKEDDSDKYCKLDLQVSGSYQYYFSLGNEKSGGGYIVVDPILHVGADNH
VLPLDCVTLQTYLAKCLGPFHEWEDRLKVARETGYNMIHFTPLQMLGLSRSCYSLADQLE
VNPEFSSHNKKCTWSDIGALVEKLKNEWNMLCITDVVYNHTATNSEWLRIHPECGYNLVN
SPHLKPAWVLDRALWHLTGMVADGKCIAKGVPPLIENDQHLNCLRKIIYEDIYPKLKLWE
FFQVDVNKAVQQFKTLLTQGKMGTKSDPNQHLEIVQDPDFRRLGCTVDMNIALATFIPHS
NGPAAIEECCNWFRKRIEELNAEQYRQTSHHQEQAVNCLVGTVVYERIACHGPKLGPISR
KHPLVTRYFTYPFEERTVEEEENMIHQPDKACYFMAHNGWVMGDDPLRNFAEPGSNVYLR
RELICWGDSVKLRYGNKPEDCPYLWAHMKKYTEITAKYFHGVRLDNCHSTPIHVAEYMLD
TARKLRADLYVVAELFTGNEELDNIFVNRLGITSLIREAMTAYNSHEEGRLVYRFGGEPV
GSFVQPRLRPLMPAIAHALFMDITHDNECPIQHRSAYDALPSAMIVSMACCATGSTKGYD
ELVPHQISVVSEERFYAKWNPAAHLTSGEVNFQTGILAGRLAINRLHQELGAKGFNQVYV
DQVDEDIVAVTRHCPNTHQSVVAVCRTAFRDPKTCFYSKEVPEMCIPGKIDEVVLEARTV
ERSASPYKKDLHFINGLPNFTVELREHIQIKDSKIIKQAGTAIKGPNEFVQEIEFERLTP
GSVIVFRVSLDPNAQEAVGILRNHLIQFSSHFKSGSLPDDHSAPILKTPFSSIASKLTLA
ELNQVLYRCEAEEQEDGGGCYNIPNWSPLKYAGLQGLMSVMADIRPKNDLGHPFCDNLRS
GDWMIDYVSNRLISRAGACAEVGKWLKAMFVYLKRIPRYLIPCYFDAILVGAYTTLLDMG
WHQMSSFVQNGSTFVKHLSLGSIQLCGIGKYSCLPDLSPSLHDVPYRLNEITNQKEQCCV
SLAAGLPHFSSGIFRSWGRDTFIALRGLMLVTGRYLEARNIILAYAGTLRHGLIPNLLGG
GTHARYNCRDAVWWWLQCIQEYCKIVPNGLDILRCPVSRMYPRDDSSPQPAGTVDQPLYE
VIQEAMQRHMEGINFRERNAGPQIDQKMRDEGFNVTAGIDHETGFVFGGNRFNCGTWMDK
MGESDRARNTGIPATPRDGSAVEMVGLCKSAVRWLMDLSRKNIFPFRGVTVKRHGKEEII
TYDEWDRKIQGHFEKLFFVSENPSDPNEKHPDLVHKRGIYKDSYGASSPWCDYQLRPNFP
IAMVVAPELFTPERAWKALQIVEEKLLGPLGMKTLDPDDMVYCGVYDNALDNDNYNVAKG
FNYHQGPEWLWPIGYFLRAKLYFSRLIGPEMYAKTVVMIKNVLSRHYVHLERSSWKGLPE
LTNENGQYCPFSCETQAWSIGVILEILYDM
Download sequence
Identical sequences H0Z4Q4
ENSTGUP00000005549 59729.ENSTGUP00000005549 ENSTGUP00000005549 XP_002189163.1.42559

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]