SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000005603 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000005603
Domain Number 1 Region: 54-161
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.96e-22
Family Spermadhesin, CUB domain 0.00074
Further Details:      
 
Domain Number 2 Region: 236-341
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 5.2e-20
Family Platelet-derived growth factor-like 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000005603   Gene: ENSTGUG00000005439   Transcript: ENSTGUT00000005661
Sequence length 345
Comment pep:novel chromosome:taeGut3.2.4:4:28983297:29102033:-1 gene:ENSTGUG00000005439 transcript:ENSTGUT00000005661 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLLGLLLLTSALAGRRQGAVAESDISSKFAFSGAKEQNGVQDPHHEKIITVTTNGSIHS
PKFPHTYPRNTVLVWRLVALDENVWIQLTFDERFGLEDPEDDICKYDFVEVEEPSDGTVL
GRWCGSSTVPSRQISKGNQIRIRFVSDEYFPSEPGFCIHYTLLMPHHTEAPSPSLLPPSA
LPLDVLNNAVAGFSTVEDLIRYLEPERWQLDLEDLYRPTWQLLGKAYIHGRKSRVVDLNL
LKEEARLYSCTPRNFSVSLREELKRTDTIFWPLCLLVKRCGGNCACCQQSCNECQCVPTK
VTKKYHEVLQLKPRIGVRGLHKSLTDVPLEHHEECDCVCKRNTEG
Download sequence
Identical sequences H0Z4V8
59729.ENSTGUP00000005603 ENSTGUP00000005603 ENSTGUP00000005603

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]