SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000005661 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000005661
Domain Number 1 Region: 946-1256
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.79e-69
Family Tandem AAA-ATPase domain 0.0000381
Further Details:      
 
Domain Number 2 Region: 693-944
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.73e-61
Family Tandem AAA-ATPase domain 0.0000438
Further Details:      
 
Domain Number 3 Region: 1361-1491
Classification Level Classification E-value
Superfamily Bromodomain 3.14e-32
Family Bromodomain 0.0012
Further Details:      
 
Domain Number 4 Region: 573-643
Classification Level Classification E-value
Superfamily BRK domain-like 2.49e-20
Family BRK domain-like 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000005661   Gene: ENSTGUG00000005460   Transcript: ENSTGUT00000005719
Sequence length 1567
Comment pep:novel chromosome:taeGut3.2.4:Z:64878230:64983927:-1 gene:ENSTGUG00000005460 transcript:ENSTGUT00000005719 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTPTDPGTMPHPGPSPGPGSPGPILGPSPGPGPSPGSVHSMMGPSPGPPSVPHPMPTMG
PTDYPQEGMHQMHKSIDGLHEKGMVEDVHCGSMKSMRPPHPGMGPPQSPMDQHSQGYISP
HPSPLGAPEHVSSPMSGGGPTPPQMTPSQPGPIIAGDPQVMNQPNRGPSPFSPAQLHQLR
AQILAYKMLARGQPLPENLQLAVQGKRTLPGIQQQQPPGAFNRQSGIGLHAMSGTAAGPG
AAPGMPGHTTAITPKTWTEGQAPDMNVSNAQQKLPAPAPSGRPSPAPAATQPAATMPGPS
VPQPPPGQPSPIVQLQQKQNRISPIQKPQGLDPVEILQEREYRLQARIAHRIQELENLPG
SLPPDLRTKATVELKALRLLNFQRQLRQEVVACMRRDTTLETALNSKAYKRSKRQTLREA
RMTEKLEKQQKIEQERKRRQKHQEYLNSILQHAKDFKEYHRSVAGKIQKLSKAVATWHAN
TEREQKKETERIEKERMRRLMAEDEEGYRKLIDQKKDRRLAYLLQQTDEYVANLTNLVWE
HKQAQAAKEKKKRRRRKKATEENAEGMASGLGPDGEPIDESSQMSDLPVKVTHTETGKVL
LGPEAPKASQLDAWLEMNPGYEVAPRSDSEDESGSEYEEEDEEEESSKLETDEKILLDPN
SEEVSEKDAKQIIETAKQDVDDEYSMQYSARGSQSYYTVAHAITERVEKQSSLLINGTLK
HYQLQGLEWMVSLYNNNLNGILADEMGLGKTIQTIALITYLMEHKRLNGPYLIIVPLSTL
SNWTYEFDKWAPSVVKISYKGTPAMRRSLVPQLRSGKFNVLLTTYEYIIKDKHILAKIRW
KYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRILLTGTPLQNKLPELWALLNFLLPTIFKS
CSTFEQWFNAPFAMTGERVDLNEEETILIIRRLHKVLRPFLLRRLKKEVESQLPEKVEYV
IKCDMSALQKILYRHMQAKGILLTDGSEKDKKGKGGAKTLMNTIMQLRKICNHPYMFQHI
EESFAEHLGYSNGVINGAELYRASGKFELLDRILPKLRATNHRVLLFCQMTSLMTIMEDY
FAFRNFLYLRLDGTTKSEDRAALLKKFNEPGSQYFIFLLSTRAGGLGLNLQAADTVIIFD
SDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFD
QKSSSHERRAFLQAILEHEEENEEEDEVPDDETLNQMIARREEEFDLFMRMDMDRRREDA
RNPKRKPRLMEEDELPSWIIKDDAEVERLTCEEEEEKIFGRGSRQRRDVDYSDALTEKQW
LRAIEDGNLEEMEEEVRLKKRKRRRNVDKDSGKEDGEKAKKRRGRPPAEKLSPNPPKLTK
QMNAIIDTVINYKDSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRS
LGDLEKDVMLLCHNAQTFNLEGSQIYEDSIVLQSVFKSARQKIAKEEESEDESNDDEEED
EEEESESESKSVKVKIKLNKKDEKSREKGKGKKRQSRAKAKPVVSDDDSDEDQDENDQSE
ASGSDDE
Download sequence
Identical sequences H0Z515
ENSTGUP00000005661 ENSTGUP00000005661 59729.ENSTGUP00000005661

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]