SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000005782 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000005782
Domain Number 1 Region: 3-168
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.27e-42
Family Calponin-homology domain, CH-domain 0.0000113
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000005782   Gene: ENSTGUG00000005620   Transcript: ENSTGUT00000005840
Sequence length 313
Comment pep:known chromosome:taeGut3.2.4:8:9787371:9792301:1 gene:ENSTGUG00000005620 transcript:ENSTGUT00000005840 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QIALKYDPQIEEDLRNWIEEVTGLSIGANFQLGLKDGIILCELINKLQPGSVKKNNQSKL
NWHQLENIGNFIKAIQAYGMKPHDIFEANDLFENGNMTQVQTTLVALAGLAKTKGFHTTI
DIGVKYAEKQARSFDAGKLKAGQSVIGLQMGTNKCASQAGMTAYGTRRHLYDPKMQTDKP
FDQTTISLQMGTNKGASQAGMLAPGTRRDIYDQKHILQPVDNSTISLQMGTNKVATQKGM
SVYGLRRQVYDPKYCAAPTEPVIHNGSQGTGTNGSEISDSDYQAEYPDDYHGEYQDDYQR
DYHGQYSDQGIDY
Download sequence
Identical sequences H0Z5D6
ENSTGUP00000005782 ENSTGUP00000005782 59729.ENSTGUP00000005782

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]