SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000005910 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000005910
Domain Number 1 Region: 55-123
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000113
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 2 Region: 112-150
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000602
Family EGF-type module 0.0087
Further Details:      
 
Domain Number 3 Region: 209-253
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000335
Family EGF-type module 0.011
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000005910
Domain Number - Region: 166-204
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000195
Family EGF-type module 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000005910   Gene: ENSTGUG00000005749   Transcript: ENSTGUT00000005969
Sequence length 407
Comment pep:novel chromosome:taeGut3.2.4:11:5027283:5029881:1 gene:ENSTGUG00000005749 transcript:ENSTGUT00000005969 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QECLNRQQALSVVQQMQKLLLAQEAAHLQGTRGLRQQLSILQSHLQRPATKHNEMCPQLA
APLNGRMLGRSLRVGHEVHFICDAGFRLVGSETRACRHNRTWSGTQPFCRSIDDCSSNPC
ANSGTCVDGNQSYTCLCPPGWSGPSCQSPIYSLPFPGSPCNSSFSRQPRCAEGRSGSRRC
SCDTGFQLQPGGVCQDVDECQLYQSNPQTQICLHDCLNLPGSYRCLCPPGYLLHADRNAC
EDVNECAGKQHNCSQGELCINTFGGYRCVHPKCPPPRHNTSYVKTSAFQCERNPCPMDSR
ACHLAASSISFHYLPLQANRTVPRVLFKMSTTRFVGDSLRFAITGGRGQGVFAVRRSDRQ
TGELLLTSPVAGPATLEVELEMSEFSHKVLLGKHIFKVTAFVSPYVF
Download sequence
Identical sequences H0Z5R4
ENSTGUP00000005910 ENSTGUP00000005910 59729.ENSTGUP00000005910

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]