SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000006020 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000006020
Domain Number 1 Region: 2-100
Classification Level Classification E-value
Superfamily Cytochrome b5-like heme/steroid binding domain 7.72e-25
Family Cytochrome b5 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000006020   Gene: ENSTGUG00000005781   Transcript: ENSTGUT00000006079
Sequence length 432
Comment pep:known chromosome:taeGut3.2.4:5:6347231:6354569:-1 gene:ENSTGUG00000005781 transcript:ENSTGUT00000006079 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRFTWEEIGQRNGRGPAPQERWLVIDRKVYDISHFCRRHPGGSRVISHYAGQDATDPFI
AFHLDKTLVRKYMNPLLIGELAPDQPSFEPSKNKKLVEDFRELRATVERMGLLQPNHAFF
ILCLCHILMLDVAAWLIIWYFGASLVPFLFSAVLLGTVQAQAGWLQHDFGHLSVFSKSRW
NHWVHKFVIGHLKGAPASWWNHLHFQHHAKPNCFRKDPDVNMHPLFFALGKTLSVELGVQ
KKKFMPYNHQHKYFFIIGPPALVPLYFQWYIFYFAVQRKQWVDLAWMLSFYIRFFLTYLP
FLGVKGTLGLHLLVRFIESNWFVWVTQMNHIPMHIDYDKNVDWFSTQLQATCNVHQSLFN
DWFSGHLNFQIEHHLFPTMPRHNYWKVAPLVKSLCAKHGIEYQCKPLLTAFADIVHSLKD
SGELWLDAYLHK
Download sequence
Identical sequences H0Z622
ENSTGUP00000006020 59729.ENSTGUP00000006020 ENSTGUP00000006020

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]