SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000006071 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000006071
Domain Number 1 Region: 16-112
Classification Level Classification E-value
Superfamily Cytochrome b5-like heme/steroid binding domain 1.44e-29
Family Cytochrome b5 0.00082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000006071   Gene: ENSTGUG00000005863   Transcript: ENSTGUT00000006130
Sequence length 448
Comment pep:novel chromosome:taeGut3.2.4:5:6362561:6374311:1 gene:ENSTGUG00000005863 transcript:ENSTGUT00000006130 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKGGEQGGDSGEPAAQIRFYTWEEIQKHNLRTDKWLVIDRKVYNITKWAKRHPGGQRVI
SHCAGEDATDAFQAFHINPTLVQKFLKPLLIGELAPGEPSQDRDKNSQLVEDFRTLRKTA
EDMNLFRASPLFFSFYLGHIIVMEVLAWLMISYFGTGWITTLILACILTTSQAQAGWLQH
DFGHLSVFKKSSWNHVVHKFVIGHLKGASANWWNHRHFQHHAKPNIFRKDPDVNMLHILV
LGDTQPVEYGKKLKYLTLHHQHEYFSQILLPFLIPCSHTLLIPLWSWLDPQRVPKSSWKL
TTTSPLFSKYLMKFEVQGKKKKKTKLQNRIMFLESHWFVWVTQMNHIPMEIDSEKHRDWL
SSQMAATCNIEQSFFNDWFTGHLNFQIEHHLFPTMPRHNFWKVKPLVKSLCAKYGVHYEE
KPLGKAFVDIVGSLKKSGDLWLDAYLHK
Download sequence
Identical sequences H0Z673
ENSTGUP00000006071 59729.ENSTGUP00000006071 ENSTGUP00000006071

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]