SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000006511 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000006511
Domain Number 1 Region: 2-80
Classification Level Classification E-value
Superfamily Cytochrome b5-like heme/steroid binding domain 2.09e-19
Family Cytochrome b5 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000006511   Gene: ENSTGUG00000006339   Transcript: ENSTGUT00000006575
Sequence length 358
Comment pep:novel chromosome:taeGut3.2.4:11:5802820:5814022:-1 gene:ENSTGUG00000006339 transcript:ENSTGUT00000006575 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SFSAAEVRARCARGACLVSCRRRLYDLSGFVRLHPGGEQLLRRRAGTDVSAALDGPPHRH
SENARRWLEQYYVGDIDEQEAGAGSWQRVCFQASDKAAQGTLEPEATALGAWEGDLVDWQ
KPLLWQVGYLGEKYDEWVHQPVDRPIRLFHSDFLEFLSKTAWYVVFMVWTPVVLYLSWVS
YTSLAQGNTRLFSSFTTEYSIPVHKYYFPFIFLLGMILWSLLEYLIHRFVFHMKPPASNY
YLITLHFLLHGQHHKSPFDSSRLVFPPVPAALVIGFFYGVLRLLLPEVLGLSVFVGGLCG
YVIYDMMHYYLHYGSPKKGTYLYGLKAYHVKHHFEHQKSGFGISTRFWDYPFGTLIPE
Download sequence
Identical sequences H0Z7G1
59729.ENSTGUP00000006511 ENSTGUP00000006511 ENSTGUP00000006511

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]