SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000006595 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000006595
Domain Number 1 Region: 1447-1586
Classification Level Classification E-value
Superfamily PRC-barrel domain 4.16e-63
Family RIKEN cDNA 2310057j16 protein (KIAA1543) 0.00000212
Further Details:      
 
Domain Number 2 Region: 217-326
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0000000000142
Family Calponin-homology domain, CH-domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000006595   Gene: ENSTGUG00000006408   Transcript: ENSTGUT00000006661
Sequence length 1591
Comment pep:known chromosome:taeGut3.2.4:17:9399254:9421887:1 gene:ENSTGUG00000006408 transcript:ENSTGUT00000006661 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RKMDALTDSAVEIVPLELYDSARAKIAANLQWICAKAYGIDNVPEELKDPFYIDQYEQEH
IKPPVIKLLLSSELYCRVCSLILKGDQVAALQGHQSVIQALSRKGIYVMESDDTPVSESD
LGSAPIKMSSHMAMIDALMMAYTVEMISIEKVVASVKRFSTFSASKELPYDLEDAMVFWI
NKVNLKMREITEKEIKLKQQLMESPGHQKVRYRRDHLSSRQLPYFPVLEDLMKDGSDGAA
LLAVIHYYCPEQMKLDDICLKEVTSIADSLYNIQLLREFSNEYLNKCFYLTLEDMLYAPL
VLKPNVMVFIAELFWWFENVKPDFVQPRDIQEIKDVKAVMQQKSSRPPVPISNATKRSFL
ATPASPSPAELQPPAQAAPEACSRYYLHPEEPDYLGKGGSPAFSPSHPLLPLRQKQQKSL
QGEDSPGHRHRSNSLTRVDGQPRGAVLAWPEKKPRPLSQPTPFALHHSASTDVDPGSGDS
ISLARSISKDSLASNIVNVTPKNQPHPPSVKANGKSLLNNVEMEDEDEELIAIIRSEERP
NRGDPEVQNAAARVPSIVATTWSPKTNSDPSDSKPESFYLEPLMPAVLKPAKEKQVINKE
DECGEGKQRSFVTKRLNEGHLSLIRKKATSSHGEHDLNRTFTPISSSDFTPVADPSSADA
MALGEAGVEASRPLASSSLDPSSQELSAGGFFLHAAKPDDEVTSKVSVSYGKGLSLHVQD
ATWTMVRHDSEPDLLDMDDADQDLVAIDNHPIVTKYIGEEESAKLQEDMKVKEHEDKDDA
SGRSSPCLSTISQVSSVSVASGSVRMTSFAERKLQRLNSYETKSSTSSSQKTTPDGSESC
PAPLTTWKQKREQSPNRQNKDNVNLLASELVQLHMQLEEKRRAIEAQKKKMEALSARQRL
KLGKAAFLHVVKKGKSPDGPQPLKPEHFAKEYSRHNGEDLDEVSLGSKSEEFLVKEEERE
EMLNDSQEVAKESLAFAEQHKPKDPAAIHDLEKSKIISVALLEDNVTEADINECDLSIEK
LNETISTLQQAILKISQQQELLMKSPTVPSPGSRNNSQDQKVKPSIHFVEPLSPTGMNSL
RKPPRLGQGRTPRPGRPSELKVPKDRQQNSARVKTPTPSLENLPHLRPFPPNSLAKTPTE
VGLESSPDHGSGSQEKCFFDTYRLHDESNQRALVLSTSKDANILSEMSKEVNNSFKETGL
NSSDGSGKENVPVDEPLRSKANLIEVDLSDLKAPDEGELENQDSSTDMISEGDQKSGVGF
FFKDEQKAEDELAKKRAAFLLKQQRKAEEARLRKQQLEAEVEQKRDEARRKAEEDRIRKE
EEKARRELIKQEYLRKKQQQILEEQGLGKPKSKPKKPRPKSVHREESYSDSGTKCSSTPD
NLSSAQSGSSLSLASAATTEPESVHSGGTPSQRVESMESLPILSRNPSRNTERDWENAST
ASSIASVAEYTGPKLFKEPSSKSNKPIIHNAISHCCLAGKVNEPHKNSILEELEKCDANH
YIILFRDAGCQFRALYCYYPDTEEIYKLTGTGPKSITKKMIDKLYKYSSDRKQFNVIPAK
TMSVSVDALTIHNHLWQAKRPAVPKKSQTRK
Download sequence
Identical sequences H0Z7P5
ENSTGUP00000006595 59729.ENSTGUP00000006595 ENSTGUP00000006595

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]