SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000006757 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000006757
Domain Number 1 Region: 5-298
Classification Level Classification E-value
Superfamily (Trans)glycosidases 7.02e-93
Family Amylase, catalytic domain 0.00000000026
Further Details:      
 
Domain Number 2 Region: 299-395
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 7.01e-21
Family alpha-Amylases, C-terminal beta-sheet domain 0.0000561
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000006757   Gene: ENSTGUG00000006566   Transcript: ENSTGUT00000006825
Sequence length 395
Comment pep:novel chromosome:taeGut3.2.4:4A:19618726:19626451:1 gene:ENSTGUG00000006566 transcript:ENSTGUT00000006825 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AAMALDNGLARTPPMGWLHWERFLCGTDCAAEPRRCVSEQLFVEMADRMAAEGWRDAGYE
FICIDDCWMAPTRDGQGRLQADPKRFPGGIRKLADYVHSKGLKLGIYSDVGSKTCAGFPG
SYNHYDLDAQTFASWGVDLLKFDGCNSDSLEQLAEGYRLMSLALNKTGRSIVYSCEWPFY
LRPVQQPNYTEIKQYCNHWRNFYDVYDSWSSIKSILDWTALHQDTIVKIAGPGGWNDPDM
AKLVIGNFGLSWEQSVTQMAMWAIMAAPLFMSNDLRHISPEAKWLLQNKEVIAINQDPLG
KQGYQLSKDKNFQLWERPLVALSGRAYSVAVLNQQEIGGPQKFTFYLSILGNGLACNPAC
SIRQVLPASRDCGVYSWLSSLSVEVNPTGTVLLKV
Download sequence
Identical sequences H0Z854
ENSTGUP00000006757 59729.ENSTGUP00000006757 ENSTGUP00000006757

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]