SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000006868 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000006868
Domain Number 1 Region: 592-674
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 7.91e-17
Family Putative glucosidase YicI, domain 3 0.0093
Further Details:      
 
Domain Number 2 Region: 345-610
Classification Level Classification E-value
Superfamily (Trans)glycosidases 4.42e-16
Family YicI catalytic domain-like 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000006868   Gene: ENSTGUG00000006685   Transcript: ENSTGUT00000006937
Sequence length 674
Comment pep:novel chromosome:taeGut3.2.4:5:6983086:7004826:-1 gene:ENSTGUG00000006685 transcript:ENSTGUT00000006937 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DRTMPLSRHTGQIPESTWTLGFREMTEPWKGAVGCLGVAVFFAMTIGIISWQAVEQPPEE
WVLRGRAAGMLWERGRGALLLRALPAGRPVLAIAVGSVPAAEPPPPRDRCWHDGGQFCYS
WEEDAELRLSLEPPAAPGTECYGVRWTPLRPDVTLKDCFSMANVSWYGGPSIRAQRWPLN
SAESPAQPLVSGDLSANPAGFGPILERYFLGSTGVTVTVAPDVSLLLSLESHRQFCLETP
AGRAEPLHYQLCTSEYPARSPKHLMQDFPPCRSPIWRYHGPEGSAAKIKRGLRSLVRRLK
RHRLQEGVVALGERGTAVLAAAQDLVPSERRKRQAPALVEPLELSITLSPYAGVTSSLFL
RSLRGGEAAGYWLSRQPRPGPLQIPLLTTWKGQLCARLNVTSEAALGWYLARARRLRQAL
GATYVAFEGVEGNSFLEQDVPAPAKLAGDGYTEVLAAALATLGNNTIISAGSRSSHLPLF
VQMSPLRSDWSHAGLKGLIPSVLHYSLLGYNFLIPDAVGGSVAGDTQGDPELFVRWLQIV
TFLPVMAFGTPPWLCCDAWVLNLTRQCIQRHRDFVVPLLLKYSEEWQSLGFPIFRPAWWL
SPTDPVAFTIEDEFLIGDEVLVAPITEKGQTWRDIYLPGEGHLWLDTNSARVFDGGTTLR
NYSASLAEVPVFVK
Download sequence
Identical sequences H0Z8G5
ENSTGUP00000006868 ENSTGUP00000006868 59729.ENSTGUP00000006868

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]