SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000007068 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000007068
Domain Number 1 Region: 210-295
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.000000681
Family Calponin-homology domain, CH-domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000007068   Gene: ENSTGUG00000006878   Transcript: ENSTGUT00000007137
Sequence length 309
Comment pep:novel chromosome:taeGut3.2.4:1:8180495:8201198:1 gene:ENSTGUG00000006878 transcript:ENSTGUT00000007137 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FFQKTLDAVKSWFTLFGWPKGQNPISIPYSLRCDVSIVQLTVAQETTFKRKADKDKCFFD
MFLHLNGQPIRGIAASQPLPRDPVERMFQLHWQHSELLSFLKSKGAYLSHVMPEFLLAPE
DYELWTEFQSFTRSMRSSGNLSGKRIFVLENRTFETMSKRAWTDVLLQMYKVFVLPRVSS
RMVPDPSSLESLQNMPGIKSEPLCSNIYSPYERTILIWLNKYYEKNRKIVWKDSQRGGIP
PMRWIVNFDHDLLDGLVLAAVVAAYCPYLIPTHFIKMYTNPRTHEQFIHNSLVLVKALHA
VHLDMGINV
Download sequence
Identical sequences H0Z915
59729.ENSTGUP00000007068 ENSTGUP00000007068 ENSTGUP00000007068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]