SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000007208 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000007208
Domain Number 1 Region: 7-240
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 7.66e-81
Family Calponin-homology domain, CH-domain 0.00000171
Further Details:      
 
Domain Number 2 Region: 3080-3203
Classification Level Classification E-value
Superfamily EF-hand 4.68e-52
Family EF-hand modules in multidomain proteins 0.000000579
Further Details:      
 
Domain Number 3 Region: 3205-3301
Classification Level Classification E-value
Superfamily EF-hand 8.16e-40
Family EF-hand modules in multidomain proteins 0.00000388
Further Details:      
 
Domain Number 4 Region: 997-1152
Classification Level Classification E-value
Superfamily Spectrin repeat 2.47e-27
Family Spectrin repeat 0.0029
Further Details:      
 
Domain Number 5 Region: 2061-2209
Classification Level Classification E-value
Superfamily Spectrin repeat 6.86e-24
Family Spectrin repeat 0.0026
Further Details:      
 
Domain Number 6 Region: 2746-2875
Classification Level Classification E-value
Superfamily Spectrin repeat 5.62e-21
Family Spectrin repeat 0.0047
Further Details:      
 
Domain Number 7 Region: 2520-2675
Classification Level Classification E-value
Superfamily Spectrin repeat 1.03e-20
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 8 Region: 1103-1263
Classification Level Classification E-value
Superfamily Spectrin repeat 2.49e-20
Family Spectrin repeat 0.0096
Further Details:      
 
Domain Number 9 Region: 341-447
Classification Level Classification E-value
Superfamily Spectrin repeat 4.2e-20
Family Spectrin repeat 0.0021
Further Details:      
 
Domain Number 10 Region: 1213-1367
Classification Level Classification E-value
Superfamily Spectrin repeat 2.49e-17
Family Spectrin repeat 0.0031
Further Details:      
 
Domain Number 11 Region: 1519-1674
Classification Level Classification E-value
Superfamily Spectrin repeat 1.65e-16
Family Spectrin repeat 0.0068
Further Details:      
 
Domain Number 12 Region: 523-665
Classification Level Classification E-value
Superfamily Spectrin repeat 1.92e-16
Family Spectrin repeat 0.0051
Further Details:      
 
Domain Number 13 Region: 2896-3035
Classification Level Classification E-value
Superfamily Spectrin repeat 9.95e-16
Family Spectrin repeat 0.009
Further Details:      
 
Domain Number 14 Region: 1824-1965
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000202
Family Spectrin repeat 0.0029
Further Details:      
 
Domain Number 15 Region: 1627-1773
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000105
Family Spectrin repeat 0.0079
Further Details:      
 
Domain Number 16 Region: 776-933
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000391
Family Spectrin repeat 0.014
Further Details:      
 
Domain Number 17 Region: 3042-3079
Classification Level Classification E-value
Superfamily WW domain 0.0000000000445
Family WW domain 0.00014
Further Details:      
 
Domain Number 18 Region: 455-555
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000142
Family Spectrin repeat 0.0059
Further Details:      
 
Domain Number 19 Region: 2284-2416
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000326
Family Spectrin repeat 0.0064
Further Details:      
 
Domain Number 20 Region: 2208-2318
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000684
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 21 Region: 2466-2534
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000791
Family Spectrin repeat 0.0048
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000007208
Domain Number - Region: 1338-1429
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00138
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number - Region: 284-338
Classification Level Classification E-value
Superfamily Acetoacetate decarboxylase-like 0.0759
Family Acetoacetate decarboxylase-like 0.014
Further Details:      
 
Domain Number - Region: 3293-3322
Classification Level Classification E-value
Superfamily RING/U-box 0.0989
Family ZZ domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000007208   Gene: ENSTGUG00000006887   Transcript: ENSTGUT00000007279
Sequence length 3322
Comment pep:novel chromosome:taeGut3.2.4:1:9154708:10148444:1 gene:ENSTGUG00000006887 transcript:ENSTGUT00000007279 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAHMLWYEEVEDDYEREDVQKKTFTKWINAQFAKFGRRYIEDLFNDFRDGRRLLELLEC
LTGQKLAKEKGSTRVHALNNVNKAIHVLQRNNVDLVNIGSSDIVDGNHKLTLGLIWNIIL
HWQVKDVMKNIMAGLQQTNSEMILLSWVRQSTRSYPQVNVTNFTTSWSDGLAFNALLHSY
RPDLFDWNAVASQQSPVQRLDHAFTIARQHLGIEKLLDPEDVATAYPDKKSILMYVTSLF
QALPQQVTMEAIREVEMLPRHTRITREEHVEVHEQHFSQEITVSAPQGPSPSPKPRFKSY
AYAQAVYVTSPDQKRRQVPPQFLESVEEKKFSTVRMGAGDLENYQTALEEVLTWLLSAED
ALQAQGDISNDVEVVKEQFHTHEGFMMELTAHQGRVGNVLQVGSQLLSTGKLSDEEENEI
QEQMNLLNSRWESLRVASMEKQSNLHKILMDLQNQQLAQLADWLTKTEERTKKTDLEPLG
PDLEDLKRQIEEHKAFQEDLEQEQVKVNSLTHMVVVVDENSGDRATAALEEQLQHFGKRW
AAICRWTEERWVLLQDILRKWQHFAEEQCLFDAWLTEKEDDVSKIHTTGFGDQNEMLTNL
SKLAILKGDLEMKRQMMSKLKLLSQDLLVAVKNKAVAQKLESRLENFAQRWESLVQKVES
NSKQISQAVTATQTSLTQTTVMETVTMVTTREQILVKHAKEELPPPPPHKKRQLLVDSEI
RKRFDSDTTELHSWMTRSEAVLQSPEFAIFRKEGNLSDLRERVNAIQREKPEKYRKLQDA
SRSAEALVEQMVNEGLNPDNIRKASEQLKSRWIEFCQLLSERLAWLEYQNNIIDFYSQLQ
QLEQTAIAAENWLKTQPTPATDPATVKTQLERCKDEIIRMSTLQPQIERLKAQSQALKEK
EQAPVFLDADLAAFTSHFKQIFADMHAREKQLQTIFDSLPPAHYKETMNTILVWMQQSET
KLSTPQVAIAEYEIMEQRLREFKALQSSLQEQQKGLTYLSTTVEDLSRKAPTEVSQSYRS
EVEVVLGRWKKLSAQLAEHCQRLEERMTKLQRFQNDTRTLKKWMAEVDVFLKEEWPALGD
SEALEKQLEQCTALVNDIQTIQPSLNSVNETGKKMKSEAEPEFASRIESELKDLNAQWDH
ICQQAYAKKAALKGGLDKTVSLRKDLSEMHEWITQAEEEYLERDFEYKTPDELQKAVEEL
KRAKEEALQKEVKVKLITDSVNNFIAKAPPAAHEALKKELDVLITSYQQLCSRLNGKWKT
LEEVWACWRELLSYLDAENKWLNEIEMKLKATENVQGGAEEISECLDSLERLMRHPEDNR
NQIRELAQTLTDGGILDELINEKLEKFNSRWEELQQEAVRRQKSLEQSIQSAQETDKTLR
LIQESLAVIDKQLTAYAADRVDAAQVPQEAQKIQSELTSHEISLEEMKKRNRGKDAAKRV
LSQIDVAQKKLQDVSVKFRLFQKPANFEQRLQECKRILDEVKLQVPKLDMKSVEQEVVQS
QLDHCMKLYKNLSEVKSEVETVIKTGRQIVQKQQTENPKELDERLTALKLQYNELGAKVT
EKKQELEKCLKLSRKLRKEINALTEWLAATDAELTKRSAVQGMPRNLDAEIAWGKATRKE
IEKRQVQLKSISDLGENLKAVMKGKESLVDDKLSLLNSNWKAVTSRAEEWFNLLLEYQKH
MEAFDQNVANVTTWMYRAEILLDESDKQKPQQKEEILKRLKAELNDIHPKVDSVRDQARD
LMANRGEHCRKVVEPKLSELNQRLAAISQRIKSVKPFIPLKELEQFDFDIQKMLEPLEVE
IQQGVNLKEEDFNKDMSEEDESTVKELLQRGDRLQKGVTDEKKREEIKTKQQLLRTKHNA
LKDLRAQRRKKALEISHQWYQYKRQADDLMTWLDDIEKKLAGLPDHKDEQKLKEIGGELE
KKKEDLNAVHRQAERLSKDGAAKAVEPTLIQLSKRWQDFESKFAQFGRLNYAQIQTVRED
TTFVMTETRTVETTHVPSTYLAEIHHLLQALSEVEERLNSPVLQAKDCENLFKQEECLKS
IKDSLGRLQGHVEIVNNKKTAALQNVTPKEAANIQEKLTQLNFEWEKLNKMYRDRQARFD
KSLEKWQIFHSDMKRFNHWLNETEEKLSRAQIEAGDVGLVKTKQFIQELQDGIGQQQTFV
KTLNATGEEIIEQSSKADAKVLKEQLESLNNRWKEICRQLVEKKKRIEEEKNILSEFQED
LNKLILWLEEADNIICIPLEEGNEDQLRDCLSKVKLRVGELPPHKGILKRLNETGGIALG
SASLNPDKKHKLESTLKEANHRLLKVSKDLPDKQKEIEILLKDFVELDQQLNQVIPWITP
VKNQLELYNKVGQPGAFDIKETEAAVQAKQPNVEEVLSKGCHLYKEKPATHPVKKKLEDL
NADWKAIQNLIQQLKEKPALAAFGHLSSGVLTPGETVAADTQTRVTKETTTFKPEMPSSV
LLEVPALADFNKAWAELTDWLSRLDREIKSQRVKVGDLDDINDMIIKQKAILQDLEQRRP
QLDELITAAQNLKNKTSNQEARTIITDRIEKIQSQWDEVHGYLQSRRQQLQEMLKDSTQW
LEAKREAEQVLEQAKAKLESWKEISYTVEALKKQNTELKQFSKEIRQWQINVDVANDMAL
KLLRDYSADDTRKVQLMTDSINASWAAINKRVCEREAALESALRMLQQFYLDLEKFLAWL
TEAETTANVLQDATHKEKTLEDAKMVRDLMKQWQELQAEIDAHTDIFHSLDENGQKILRS
LEGSEDATLLQRRLDNMNLRWSELRKKSLNIRSHLEASTDQWKRLHLSLQELLAWLQLKE
DELKQQAPIGGDLPTVQKQNDIHRTFKRELKTKEPVIRSALETVRIFVAEQPVEAVEKVC
PEPRDLSPEERAHNITKLLQRQADEVRTEWDKLNLQSADWQKKIDDALERLQGLQEAMDE
LDLKLRQAEAFKGSWQPVGDLLIDSLQDHLEKVKVYRAELVPLKEKVHHVNELAHRFTPP
DIQLSQYNLSCVEDLNTRWKVLQVAVDERIKQLHEAHRDFGPTSQHFLTTSVQGPWERAI
SPNKVPYYINHETQTTCWDHPKMTELYQSLADLNNVRFSAYRTAMKLRRLQKALCLDLLS
LSAACDALDQHNLKQNDQPMDILQIINCLTTIYDRLEQEHNNLVNVPLCVDMCLNWLLNV
YDTGRTGRIRVLSFKTGVVSLCKAHLEDKYRYLFKQVASSTGFCDQRRLGLLLHDSIQIP
RQLGEVASFGGSNIEPSVRSCFQFANNKPEIEAALFLDWMRLEPQSMVWLPVLHRVAAAE
TAKHQAKCNICKECPIIGFRYR
Download sequence
Identical sequences H0Z9F5
59729.ENSTGUP00000007208 ENSTGUP00000007208 ENSTGUP00000007208

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]