SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000007589 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000007589
Domain Number 1 Region: 16-189
Classification Level Classification E-value
Superfamily PR-1-like 3.27e-51
Family PR-1-like 0.0000773
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000007589   Gene: ENSTGUG00000007373   Transcript: ENSTGUT00000007667
Sequence length 244
Comment pep:novel chromosome:taeGut3.2.4:1A:37125456:37131395:1 gene:ENSTGUG00000007373 transcript:ENSTGUT00000007667 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRKITFFFPALFLLDFFSCFCAYPLPDIEDAKFIEDCVRAHNTFRSKVSPPASNMFRMSW
DAALAKTAKAWAKKCKFNHNTYLEMPGKMHPTFHFVGENIWTGTARIFSVDAALGSWFNE
VSSYDFSTNTCTDMCGHYTQVVWAESYKVGCAVHFCNTVENFPGLFKAAHFVCNYGPAGN
YPRKPYKEGQPCSRCSNEKCVDKLCENTNREKLISYDNWYPEWDTQPQPPQPRPPRPPMP
SHVP
Download sequence
Identical sequences H0ZAI5
59729.ENSTGUP00000007589 ENSTGUP00000007589 ENSTGUP00000007589

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]