SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000007599 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000007599
Domain Number 1 Region: 34-187
Classification Level Classification E-value
Superfamily PR-1-like 7.19e-53
Family PR-1-like 0.0000456
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000007599   Gene: ENSTGUG00000007376   Transcript: ENSTGUT00000007677
Sequence length 200
Comment pep:novel chromosome:taeGut3.2.4:1A:37133642:37142226:1 gene:ENSTGUG00000007376 transcript:ENSTGUT00000007677 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPVAMTSRISTYVVALLLFCYSSDSFDPSTLPDPRDPEFIRQCVQTHNALRSQVDPPASN
MLYMSWDPDLAKLAKAWAKKCLFKHNIHLKERGKVHPRFASAGENIWTGSLPVFTVKAAL
NSWYHEVESYNYDTNRCSKVCGHYTQVVWATSYKVGCAVHFCPTVKYISIRNAAHFVCNY
GPPGNYPVRPYKTGGACSEC
Download sequence
Identical sequences H0ZAJ5
ENSTGUP00000007599 ENSTGUP00000007599 59729.ENSTGUP00000007599

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]