SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000007666 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000007666
Domain Number 1 Region: 2-146
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 6.76e-43
Family Calponin-homology domain, CH-domain 0.00077
Further Details:      
 
Domain Number 2 Region: 1208-1320
Classification Level Classification E-value
Superfamily E set domains 1e-35
Family Filamin repeat (rod domain) 0.00000547
Further Details:      
 
Domain Number 3 Region: 1119-1231
Classification Level Classification E-value
Superfamily E set domains 2e-33
Family Filamin repeat (rod domain) 0.00000474
Further Details:      
 
Domain Number 4 Region: 1322-1430
Classification Level Classification E-value
Superfamily E set domains 5.36e-33
Family Filamin repeat (rod domain) 0.00000785
Further Details:      
 
Domain Number 5 Region: 1495-1611
Classification Level Classification E-value
Superfamily E set domains 1.81e-31
Family Filamin repeat (rod domain) 0.00000517
Further Details:      
 
Domain Number 6 Region: 941-1030
Classification Level Classification E-value
Superfamily E set domains 5.74e-30
Family Filamin repeat (rod domain) 0.00000375
Further Details:      
 
Domain Number 7 Region: 622-746
Classification Level Classification E-value
Superfamily E set domains 8.67e-29
Family Filamin repeat (rod domain) 0.00062
Further Details:      
 
Domain Number 8 Region: 1720-1815
Classification Level Classification E-value
Superfamily E set domains 9.34e-29
Family Filamin repeat (rod domain) 0.000012
Further Details:      
 
Domain Number 9 Region: 333-449
Classification Level Classification E-value
Superfamily E set domains 1.13e-27
Family Filamin repeat (rod domain) 0.00082
Further Details:      
 
Domain Number 10 Region: 546-656
Classification Level Classification E-value
Superfamily E set domains 1.4e-27
Family Filamin repeat (rod domain) 0.0005
Further Details:      
 
Domain Number 11 Region: 2095-2188
Classification Level Classification E-value
Superfamily E set domains 1.73e-26
Family Filamin repeat (rod domain) 0.00000977
Further Details:      
 
Domain Number 12 Region: 1418-1513
Classification Level Classification E-value
Superfamily E set domains 3.15e-26
Family Filamin repeat (rod domain) 0.0000221
Further Details:      
 
Domain Number 13 Region: 1034-1142
Classification Level Classification E-value
Superfamily E set domains 3.87e-26
Family Filamin repeat (rod domain) 0.0000168
Further Details:      
 
Domain Number 14 Region: 736-846
Classification Level Classification E-value
Superfamily E set domains 7.34e-26
Family Filamin repeat (rod domain) 0.00055
Further Details:      
 
Domain Number 15 Region: 155-252
Classification Level Classification E-value
Superfamily E set domains 8.67e-26
Family Filamin repeat (rod domain) 0.00092
Further Details:      
 
Domain Number 16 Region: 1902-1997
Classification Level Classification E-value
Superfamily E set domains 8.67e-26
Family Filamin repeat (rod domain) 0.00000481
Further Details:      
 
Domain Number 17 Region: 439-542
Classification Level Classification E-value
Superfamily E set domains 2.74e-25
Family Filamin repeat (rod domain) 0.00017
Further Details:      
 
Domain Number 18 Region: 2415-2505
Classification Level Classification E-value
Superfamily E set domains 1.33e-24
Family Filamin repeat (rod domain) 0.0000149
Further Details:      
 
Domain Number 19 Region: 2286-2377
Classification Level Classification E-value
Superfamily E set domains 3.87e-24
Family Filamin repeat (rod domain) 0.0000174
Further Details:      
 
Domain Number 20 Region: 2193-2284
Classification Level Classification E-value
Superfamily E set domains 7.34e-24
Family Filamin repeat (rod domain) 0.0000156
Further Details:      
 
Domain Number 21 Region: 255-353
Classification Level Classification E-value
Superfamily E set domains 4.94e-23
Family Filamin repeat (rod domain) 0.0012
Further Details:      
 
Domain Number 22 Region: 2014-2108
Classification Level Classification E-value
Superfamily E set domains 1.47e-21
Family Filamin repeat (rod domain) 0.0000448
Further Details:      
 
Domain Number 23 Region: 854-954
Classification Level Classification E-value
Superfamily E set domains 3.67e-19
Family Filamin repeat (rod domain) 0.0009
Further Details:      
 
Domain Number 24 Region: 1811-1900
Classification Level Classification E-value
Superfamily E set domains 8.67e-19
Family Filamin repeat (rod domain) 0.00000858
Further Details:      
 
Domain Number 25 Region: 1660-1735
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000107
Family Filamin repeat (rod domain) 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000007666   Gene: ENSTGUG00000007383   Transcript: ENSTGUT00000007745
Sequence length 2506
Comment pep:novel chromosome:taeGut3.2.4:12:8939842:9030263:1 gene:ENSTGUG00000007383 transcript:ENSTGUT00000007745 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DSKAIVDGNLKLILGLIWTLILHYSISMPVWEDEGDDDAKKQTPKQRLLGWIQNKIPYLP
ITNFNQNWQDGKALGALVDSCAPGLCPDWETWDPKKPVDNAREAMQQADDWLGVPQVITP
EEIIHPDVDEHSVMTYLSQFPKAKLKPGAPLKPKLNPKKARAYGRGIEPHGNMVKQPAIF
TVDTISAGQGDLMVFIEDPEGNREEAKITPSSDKNKTYSVQYVPRVTGPHKVSVLFAGQH
ISKSPFEVNVDKAQGDASKVTAKGPGLEAAGNIANKPTYFDLYTAGAGVGDVIVEVEDPQ
GRSLAEVVVEDKGNQVYRCTYKPVQAGPHIVKVTFAGEAIPKTPCTVLIGEACNPNACRA
TGRGLQPKGVRIRETADFKVDTRAAGSGDLGVIIKGPKGLEELVKQKGFMDGIYAFEYYP
ATPGKYVVTITWGGQNIPKSPFEVQVGHEAGPQKVRAWGPGLHEGVVGKSADFVVESIGT
EVGSLGFAIEGPSQAKIECDDKNDGSCDVKYWPKEPGEYAVHIMCDDEDIKDSPYMAFIR
PASGDFNADKVKAYGPGLERTGCIVNNPAEFTVETKDAGKAPLKMYAQDGEGNPIDIQIK
SKPDGVFACSYVPVKPIKHTISVVWGGANVPNSPFRVLIGQGSHPQKVKVFGPGVERTGL
KASEPTHFTVDCTDAGEGDVSVGIKCDARVVSSEEEDIDFDIIHNANDTFTVKYSPPAAG
RYTIKVLFAGEEIPASPFRVKVDPSHDASKVKAEGPGLNKTGVENGKPTHFTVFTKGAGK
APLDVQFSSSVPGEAVMDLDIIDNYDYSHTIRYTPIQQGPMKVLVTYGGDPIPKSPFTVG
VAAPLDLSKVIVNGLENRVEVGKDQEFVIDTKGAGGQGKLEVNISSPMRKAVPCLVEPVL
GKECSTAKYIPREEGLYVVDVSYDGNPIPGSPYTVEATLPPDPSKVKAHGPGLRGGLVGK
PAQFTIDTKGAGTGGLGLTVEGPCEAKIECSDNGDGTCSVSYLPTKPGEYFVNILFEEVH
IPGSPFKADIEMPFDVSKVIATGPGLERGKVGEAGLLNVDCTEAGPGDLRVDMVSDTGSK
AEVQIDDNKDGTYVVTYVPLSAGMYTIKMRYGGEQVPKFPARVKVEPAVDTSRVKVFGPG
VEGKDVFREATTEFTVDARPLTKAGGDHIRTQITSPSGSPTDCLIQDNADGTYSVEYTPF
EKGPHSVSVTYDGVPVPNSPFRVNVAEGCHPSRVKAQGPGLTEAFTNQPNAFSVVTRGAG
IGGLGITVEGPSESKISCKDNKDGSCSAEYIPYVPGDYDVNITYGGEHIPGSPFKVPVKD
VVDPSKVKIAGPGLGTAVRAKIPQSFTVDTSKAGIAPLEVVVTGPRGVVGPVNVVDNGDG
THTVVYTPMQEGPYMITVKYADEEIPRSPFKVKVLPTYDASKVTASGPGLSSYGILASLP
VEFAVDAKDAGQGLLAVQITDQEGKPKRVDIHDNKDGTYMVTYVPDKTGRYTIGVKYGGD
DIPASPYRIRASPAGDASKCLATGPGIAPTVKTGEEVGFVVDAKSAGKGKVTCTVLTPDG
TEAEADVVENEDGTYDIFYTAAKPGTYVIYVRFGGVDIPNSPFTVMAVDADDVAAQSQEP
VGASPPGFRPWVTEEAYVPVGDMNGMGFRPFDMVIPFAVRKGEITGEVHMPSGKMDTPDI
VDNKDGTVTVKYAPTEVGLHEMHIKYMGNHIPESPLQFYVNYPNSGSVSAYGPGLIYGIA
NKPATFTIVTEDAGEGGLDLAIEGPSKAEISCIDNKDGTCTVTYLPTLPGNYSILVKYND
KHIPGSPFTAKITDDNRRRSQVKLGSAADFMLDINETDLSLLTASIKAPSGRDEPCLLKR
LPNNHIGISFIPREVGEHLVSIKKNGSHVPNSPVTIMVVQSEIGDARRARVFGRGLVEGR
TFEMCDFIVDTRDAGYGGISLAVEGPSKVEIQTEDLEDGTCKVSYFPTVPGVYIVSTKFA
DEHIPGSPFSVKISGEGRVKESITRTRRAPSVATVGSICDLNLKIPEIDCADMTAQVTSP
SGRNFDAEIVECDKNTYCVRFVPQEMGVHTVDVKYKGQPVPGSPFQFTVGPLGEGGAHKV
RAGGPGLERGETGVPAEFSIWTREAGAGGLSIAVEGPSKAEITFDDHKDGSCGASYIVQE
PGNYEVSIKFNDEHIPESPYLVPVIAPSDDARRLTVTSLQESGLKVNQPASFAIRLNGAK
GKIDAKVHSPSGAVEECHVSELEPDKYAVRFIPHENGIHTIDVKFNGSHVVGSPFKVRVG
EPGQAGNPALVTAYGSGLESGTTGLQSEFFINTTKAGPGTLSVTIEGPSKVKMDCQETPE
GYKVMYTPMAPGNYLIGVKYGGPNHIVGSPFKAKVTGQRLVSPGSANETSSILVESVTRS
STETCYSAIPKSTSDASKVVSRGAGLSKAFVGQKSSFSVDCSKAGSNMLLVGVHGPTIPC
EEVSIKHLGSHQYNVTYVVKERGDYVLAVKWGDEHIPGSPFHVTVP
Download sequence
Identical sequences H0ZAR1
59729.ENSTGUP00000007666 ENSTGUP00000007666 ENSTGUP00000007666

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]