SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000007785 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000007785
Domain Number 1 Region: 29-204
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.19e-37
Family Calponin-homology domain, CH-domain 0.00083
Further Details:      
 
Domain Number 2 Region: 2022-2159
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000131
Family Nucleotide and nucleoside kinases 0.091
Further Details:      
 
Domain Number 3 Region: 2051-2103,2169-2256
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000327
Family Nucleotide and nucleoside kinases 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000007785   Gene: ENSTGUG00000007519   Transcript: ENSTGUT00000007868
Sequence length 2387
Comment pep:novel chromosome:taeGut3.2.4:1A:38040492:38297367:1 gene:ENSTGUG00000007519 transcript:ENSTGUT00000007868 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVLGVASKLRQPAVGSKPVHTALPIPSLGSTSSQKYSPKSLELTGAESSMLSCQLTLKS
TCDFGERKTLQGKTQEIEDSKIYTDWANHYLAKSGHKRLIKDLQQDIADGVLLAEIIQII
ANEKVEDINGCPRSQSQMIENVDVCLSFLAARGVNVQGLSAEEIRNGNLKAILGLFFSLS
RYKQQQHHQQQYYQSLVELQQQVTSTPAEISQSKTHQDMQSSLTARYATQSNHSGIATSQ
KKASRLPGPSRVPAAGSSTKVQGASNLNRRSQSFNSIDKNKPPQYANGNEKDSPKGPNPS
SGMNGNVQHPTSTGQQQVSAIPSPSASKPWRSKSMNVKHSATSTMLSVKQPSPATSPTPT
SDRLKPPPSEGVKPPSSGQKSMLEKFKLVNARTALRPPLSLSSGPSDSGREDDNFSECGE
MDVLSGGVNSGGSTSSSPKVSPKLAPPKAGSKNLSNKKSLLQPKDKEEKNRDKNKVCTEK
AVKEEKDQVTESSTKKSSKIASLIPKGSKTTATKKESLVSSSSGIPKPGSKVPTAKQSTS
STCTGSKEVEKLRTTKGNQSQSTPKSQFSEKASPSAGLSSSEGKEPSAALPPGSSVGLSA
SMAAGSGQGTGNGVVQLPQQQQYSHPNTATVAPFIYRTLSENDSTSLPPADSCTSPTKMD
LSFSKTAKQCLEEISGEDPETRRMRTVKNIADLRQNLEETMSSLRGTQISHSTLETTFDS
TVTTEVNGRSIPSLSSRSTPVTWRLGQASPRLQAGDAPSLGAGYPRSSASRFIHTDPSRF
MYTTPLRRAAVSRLGNISQIDMSEKGTGDLDISSEADVGGYMSDGDILGKSLRTDDINSG
YMTDGGLNLYTRSLNRIPDLAASRDVIQRGVHDVTVDADSWDDSSSVSSGLSDTLDNLST
DDLNTTSSVSSYSNITASSRKNTHAQTDSEKRSVTDSETWGSTEELKKPEEDFDSSVDSS
GKWKGLPSGLSEESEKGGQKTSLSVSQTGSWRRGMTAQVGTTQSRHKAGTSALKTPGKTD
DAKASEKVKTPLKGASIQRSPSDAGKSSGDEGKKPPSGIGRSTATGSFGFKKSGLGSSTI
ITTSGATITSGSATLGKIPKSSAISGKSNAGRKTSLDGSQNQDDGVLHVSSKTTLQYRSL
PRPSKSSGSGIPGRGGHRSSTSSIDSNVSSKSAGAAATKLREPSKIGSGRSSPVTVNQTD
KEKEKVAVSDSESVSLSSSPKSSPTSASASGTPGLRQPGSKYPDIASPTFRRLFGAKASG
KAASAPSTEGVKPTSAMPSPSTTLARQGSLESPSSGTGSMGSAGGQSGSSSPLFSKPSDL
NADVVSLSHSLASSPASVHSFTSGALVWAANLSSSSAGSKDTPSYQSMTSLHTSSESIDL
PLSHHGSLSGLTTSTQEVQSLLMRTGSVRSTLSESMQLDRNTLPKKGLRYTPSSRQTSQE
EGKEWLRSHSTGGLQDTGSQSPLVSPSAMSSSATGKYHFSNLVSPTNLSQFNLPGPSMMR
SNSIPAQDTSFELYDDSQLCGSATSLEERPRAISHSGSFRDSMEEVHGSSLSLVSSTSSL
YSTAEEKAHSEQIQKLRRELVASQEKVATLTSQLSANAHLVAAFEKSLGNMTGRLQSLTM
TAEQKESELIELRETIEMLKAQNSAAQAAIQGALNGPDHTHKDLRIRRQHSSESVSSINS
ATSHSSIGSGNDADSKKKKKKNWVTSLSANLRSSFKQAFGKKKSTKPPSSHSDIEELTDS
SLPSSPKLPHSSGECATTSMKPSQSASASSLFWASKKRQNGRVVYKHRSRICECTEAEAE
IILQLKSELREKELKLTDIRLEALSSAHHLDQIREAMNRMQNEIEILKAENDRLKAETGN
TGKPARPPSESSSSTSSSSSRQSLGLSLNNLNITESVASDILLDDVTDGTLHKEGHSVKI
LVTINKGYSRAKDQKPHAYLIGSIGVSGKTKWDVLDGVIRRLFKEYIFRVDPTTSLGLSS
DCIASYCIGDVTRAHSLEVPELLPCGYLVGDNNIITVNLKGVEENSLDSFVFDTLIPKPI
TQRYFNLLMEHRRIILSGPSGTGKTYLANRLAEYIITKSGRKKPEDAIATFNIDHKSSKD
LRQYLASLAEQCSADNNGADLPVVIILDNLHHISSLSDIFNGFLNCKYNKCPYIIGTMNQ
GVSSSPNLEMHHNFRWVLCANHTEPVKGFLGRYLRRKLIETEIEKSIRNNELIKIIDWIP
KTWHHLNSFLETHSSSDVTIGPRLFLPCPMDVDGSRVWFTDLWNYSLVPYLLEAVREGLQ
MYGKRAPWEDPSKWVADTYPWSSATLQHEWPSLLQLRPEDVGYEGYASAKEGTTSKHVPQ
TDTEGDPLMNMLMRLQEAANYSSAQSCDSDSTSHHDDILDSSLESTL
Download sequence
Identical sequences H0ZB28
59729.ENSTGUP00000007785 ENSTGUP00000007785 ENSTGUP00000007785

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]