SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000007794 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000007794
Domain Number 1 Region: 32-282
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.92e-93
Family Calponin-homology domain, CH-domain 0.00000381
Further Details:      
 
Domain Number 2 Region: 299-419
Classification Level Classification E-value
Superfamily Spectrin repeat 7.98e-34
Family Spectrin repeat 0.0000843
Further Details:      
 
Domain Number 3 Region: 1643-1796
Classification Level Classification E-value
Superfamily Spectrin repeat 3.34e-27
Family Spectrin repeat 0.002
Further Details:      
 
Domain Number 4 Region: 1011-1167
Classification Level Classification E-value
Superfamily Spectrin repeat 9.82e-27
Family Spectrin repeat 0.0000661
Further Details:      
 
Domain Number 5 Region: 1854-2008
Classification Level Classification E-value
Superfamily Spectrin repeat 2.33e-26
Family Spectrin repeat 0.0016
Further Details:      
 
Domain Number 6 Region: 1230-1378
Classification Level Classification E-value
Superfamily Spectrin repeat 4.05e-25
Family Spectrin repeat 0.00064
Further Details:      
 
Domain Number 7 Region: 428-530
Classification Level Classification E-value
Superfamily Spectrin repeat 3.27e-22
Family Spectrin repeat 0.00033
Further Details:      
 
Domain Number 8 Region: 819-951
Classification Level Classification E-value
Superfamily Spectrin repeat 1.55e-20
Family Spectrin repeat 0.002
Further Details:      
 
Domain Number 9 Region: 643-744
Classification Level Classification E-value
Superfamily Spectrin repeat 3.84e-20
Family Spectrin repeat 0.00041
Further Details:      
 
Domain Number 10 Region: 1478-1594
Classification Level Classification E-value
Superfamily Spectrin repeat 4.58e-17
Family Spectrin repeat 0.00042
Further Details:      
 
Domain Number 11 Region: 523-643
Classification Level Classification E-value
Superfamily Spectrin repeat 3.66e-16
Family Spectrin repeat 0.0014
Further Details:      
 
Domain Number 12 Region: 1990-2074
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000034
Family Spectrin repeat 0.0013
Further Details:      
 
Domain Number 13 Region: 747-851
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000468
Family Spectrin repeat 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000007794   Gene: ENSTGUG00000007501   Transcript: ENSTGUT00000007878
Sequence length 2077
Comment pep:novel chromosome:taeGut3.2.4:5:7991577:8001726:1 gene:ENSTGUG00000007501 transcript:ENSTGUT00000007878 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TGTMTSANDYEQLELQQQYSRINVRWDASDDELDNDNSSARLFERSRIKALADEREAVQK
KTFTKWVNSHLARVTCRISDLYMDLRDGRVLIKLLEVLSGELLPKPTKGRMRIHCLENVD
KALQFLKEQRVHLENMGSHDIVDGNHRLVLGLIWTIILRFQIQDIIVETQEGRETRSARD
ALLLWCQMKTAGYPHVNVTNFTSSWKDGLAFNALIHRHRPELVDFQNLTKSNARHNLEHA
FSVAERHLGITPLLDPEDVFTENPDEKSIITYVVAFYHYFSKMKVLEVEGRRLGKVIEHA
KETERMIEGYGGLASDLLTWIEQTIASLNSRSFANSLAGVQHQLQAFSTYRTVEKPPKFQ
EKGNLEVLLFTIQSRMRANNQRVYTPHEGRLVSDINRAWEQLEKAEHERELALRNELIRQ
EKLEQLARRFDRKAAMREAWLSENQRLVAQDNFGQDLAAVEAAKKKHEAIETDTAAYRER
VQAIEAVAKELELEGYHDIQRINGRKDNILRLWEQLLELLAARRQRLEMNLTLQHLFQEM
LHCIDWMDEVKVKLASPESGKHLLEAEELLQTHRLLEADMAVQAEKTRAISAAALRFADA
EGYRPCDPKVIRDRVSHLEMCRRELQVLAARRRALLEQSRSLWTCLWELDEAESWIKEQE
QLYSSLDFGKDLPGVLLLQRRHAAFEAELRSRGGRLEQTLAVGEGLAAAGRAAEQLQERG
AAVRALWAQLEELAAFRRRGLREAEGFFQFQAEVEELAEGLQDARRRAAAEELGQDESRT
LVLLRQHQELLDELAAAREQLDRLAQQAEGFPPELRAGPEAQSRLAALRELHAEAAALAE
RRGRQLQDALDLYTVFGESDACHLWMGSKETWLGELEVPQALEDLDVTQRRLDGLEQDMA
TVASQIAAVNQAADGLLASGHPRSPQVRQCREQLNERWGRFRELVLQRQRAVGSALRLLN
YNLESEETQKWLQSKARAVEATAELGRDLAGVLATQRKLYGIERELAVAQDRLAALRSQA
ERLAEERPEAATEVAQKLAMATSAWDELQAALAERAASLGEAGQLRSFLQDLDDFQAWLF
SAQKAVAAVDEVPASLGEAEEMLQRHEAARRDAEDHAGAFAALAEAGERVLGGQTDPEYE
GLRQRLGGVKDGWAALGKMAEARKRFLTQCRDFQEFLRDTKQAEILLTKQEYTLSHLELP
STLEGSAAALHRFQNFRAGVESNAKKVPEVVVGGTKLVAEENIFAEKISEKCRTLQERHG
AVMDKVEEAAGLMQDNHDLQTFLQSCREFDAWVDEKMLMAQDVSYGEARGLHSKWQKHQA
FMAELAPNQSWLEKIEAEGTELAARKPQYGALVTQRLEELRRRWAELRSAAEDKGRQLFE
AERSALYARSYGELESWLGRAQEELRHAEKVMKFIPNSHGFVCQRLEEQVRTWMKELEEL
GWQGTPGTGDVPDTTRQEQMLRQRVLELLEPLERKRKELETAKAMYQLGRDLEDETLWVQ
ERLSLARSTDHGTDLPSVQRLTKRNETMQKELAGHAPRLGEVLSRAEAVGSGEEPGPELA
AQAQELQALWATLQEEAAARHRRLREAEEAQQYYLDADEAEAWVSEQELFMGPEEKPKVR
TALMMLKRHVRQLRSIEDYGQTIKELAGRAQQLLSAGYPEGEQIIRLQGQVDKHYAGLKE
AAEERRRRLENMSHLFQLKREVEELEQWIAERDVVASSPEMGQDLDHVMLLREKFREFAR
ETGSVGQERVDRVNLTIEDLIDAGHIEAATIAEWKDGLNESWADLLELIDTRMQLLAASH
DLHKYFYDGAELLALIATRRQELPQDLGEDAGTVEAFHRMHNAFERDLQLLEAQVQQFRE
TAARLQTAYAGEKAAGIQEKEQEVSRALQELLEACSGRRARLTDTADKHRFFSMARDLLS
WMESTVRQIETQEKPRDVSSVELLMKYHQGIKAEVDARGKNFTNCIELGKKLLQRKHQDS
PEIKVKLVELVDKRKAMMETWEQRWERLRLLLEVCQFSRDASVAESWLIAQEPYLASSDY
GQTVDAVEKLLKRHEAFEKSSATWEERIAALRKLTTV
Download sequence
Identical sequences H0ZB36
ENSTGUP00000007794 ENSTGUP00000007794 59729.ENSTGUP00000007794

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]