SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000008887 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000008887
Domain Number 1 Region: 1-82
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0000116
Family Calponin-homology domain, CH-domain 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000008887   Gene: ENSTGUG00000008618   Transcript: ENSTGUT00000008982
Sequence length 991
Comment pep:novel chromosome:taeGut3.2.4:4:47238396:47305702:-1 gene:ENSTGUG00000008618 transcript:ENSTGUT00000008982 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DNIILFLRGCKELGLKESQLFDPGDLQDTSNRVTIKNIDYSRKLKNVLVTIYWLGKAANS
CTSYSGSTLNLKEFEGFLAQMRKETEDIESPKRSIRDSGYIDCWDSERSDSLSPPRHGRD
DSFDSLDSFGSRSQQTPSPDVVLRGSSDGRGSDSETDLPHRKMPDVKKDDMLARRTSHGE
PKSAVPFNQYLPNKSNQTCYVPAPLRKKKAEREEYRKSWSTATSPLGDRPFRFGPRTAVS
DDAESMSMFDMRCEEEAVAQPHSKARHEKLQNIHNQLKEDETRWQDDLARWKSRRRSASQ
DLIKKEAERKKMERLLAGDGTNERRKSIKTYREIVEEKERRERELHEAYKNAKTQEEAES
ILQQYTERFTISEAVLERLQMPKILERSHSKPNSPLKDPNPLKYLRQQASLPKDMLLKQV
GSGVADSHVVNSVKPTGMGDPSLWSLGKEYVCLTLQPGHLPLGSQGLLLFWPVDGKVSMN
GENVNGMEEKDKECTTVIFTPSPTRSLKFDGVARGDKPPVELKKDPPSVELSLQRPATHL
QAEPSPSSATPAPSESPSPGGCACAAALTLPCPSPDQKQFKSTAACSSPVVKRLEFFPSP
VPSEETASSKKDVKKVEIEPQKEAELPSTQEVIKAKPLEEKGSVVLPFLKKLPETSQVTL
HNSGLQVFSGSHVKCSVTHFNFWSWDPEEERKRQERWQHEQERLLQEKYQKEQYKLKEEW
EKAQREVEEEERRYYEEERKIIEDTVVPFIVSSNSAELLSSSSSTTGGNKTVVSFSWKSG
SCKSKGIPWVPSLTGDASYKLLPSHFQLEQRMILSLCSCLLVLNPKSQVIYKKKLCNEKG
TPVISDNKNHSFDHQALSDKGPTESQTDSEPKILRFTNWNFSIKKLVLFVVQLQAGYHEN
FRSGPSSPCSLAALSQSPNRSVSGKKLCSTCGLPLGKGAAMIIETLGLYFHIQCFRCGVC
KGQLGDAASGTDVRIRNGLLNCNDCYIRSRS
Download sequence
Identical sequences H0ZE75
59729.ENSTGUP00000008887 ENSTGUP00000008887 ENSTGUP00000008887

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]