SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000009026 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000009026
Domain Number 1 Region: 251-343
Classification Level Classification E-value
Superfamily EF-hand 1.12e-26
Family Eps15 homology domain (EH domain) 0.0000118
Further Details:      
 
Domain Number 2 Region: 110-213
Classification Level Classification E-value
Superfamily EF-hand 3.57e-24
Family Eps15 homology domain (EH domain) 0.00000737
Further Details:      
 
Domain Number 3 Region: 15-103
Classification Level Classification E-value
Superfamily EF-hand 1.91e-18
Family Eps15 homology domain (EH domain) 0.0000286
Further Details:      
 
Domain Number 4 Region: 369-479
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000000994
Family Myosin rod fragments 0.0046
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000009026
Domain Number - Region: 463-536
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0994
Family Myosin rod fragments 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000009026   Gene: ENSTGUG00000008685   Transcript: ENSTGUT00000009123
Sequence length 915
Comment pep:known chromosome:taeGut3.2.4:8:21570471:21609378:-1 gene:ENSTGUG00000008685 transcript:ENSTGUT00000009123 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IFSLVSFLQLSSANPVYEKFYRQVDSANAGRVLASDAAVFLKKSGLTDLVLGKIWDLADT
DGKGILNKQEFFVALRLVACAQNGLDVSLSSLNLPVPPPRFTDTSSPLLLSGTASSDLPW
AVKLEDKVKYDSIFDSLNPVNGLLSGDKVKPVLLNSKLPVDILGRVWELSDIDHDGMLDR
DEFAVAMFLVYCALEKEPVPMSLPAALVPPSKRKPLSVPGAMPLIPSSTKESHQSLPPVG
ILAAKTPLTQWVVSPADKIKYDEIFVKTDKDMDGFVSGVEARELFLKTGLPSTLLAHIWA
LCDTKDCGKLSKEQFALAFHLINQKLTKGIDPPQALTPEMIPPSDRGVSLQKSTQGLNSV
ADFSAIKELDTLNNEIVDLQREKNNVEQDLKEKEDAIKQRTSEVQDLQDEVKRESNNLQK
LQAQKQEAQETLNDLDEQKAKLEEQLNDIRQKCAEEAHLIAMLKAEITSQESKISAYEDE
LTKAQEELSRLQQETAELEHCIESGKAQLGPLQQHLQDSQQEINSVQTKLLELKELENNQ
FSWHSQPHSTLVNGTVDHSSLSNSSSETANLNENAERESIAEEEQTNSVSPVRNSPETAV
SVREEKETPAATVTKKEDPFDAESHPLPDLVSEASLEFFQSDPFVGNDPFKDDPFGKIDP
FGGDPFKGSDPFAADSFFKQSSTDPFVTAGTDPFSSADNSNNTTTEISKKNDPFAPGGTT
VTTSNDLATDPFASLFGSESFEGGFADFSTLSKANNEDPFSSSTSGSVSSVTITKNLFEE
APAKNEDVPPALPPKTGTPTRPCPPPPGKRPINQIDSSDSFKSSDPFQPFPTPDIPKEQE
ADLFCDPFAPTSVSKEADPNNFANFSTYSTEEDMIEWAKRESEREEKERLARLKQQEQED
LELAIALSKSEISEA
Download sequence
Identical sequences H0ZEL4
ENSTGUP00000009026 ENSTGUP00000009026 59729.ENSTGUP00000009026

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]