SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000009146 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000009146
Domain Number 1 Region: 2-146
Classification Level Classification E-value
Superfamily PR-1-like 1.11e-45
Family PR-1-like 0.000000219
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000009146   Gene: ENSTGUG00000008888   Transcript: ENSTGUT00000009245
Sequence length 149
Comment pep:novel chromosome:taeGut3.2.4:2:95001810:95031072:-1 gene:ENSTGUG00000008888 transcript:ENSTGUT00000009245 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SKQFAEEVLKVHNDYRKKHGVPPLKLCKKLNRGAQQYAEELATTRVLKHSSESANGNCGE
NLAWASYDQSGKDVADRWYSEIKNYSFQNPGFSSRTGHFTAMVWKNTKKMGVGKASASDG
STFVVARYDPAGNVVNPGYYEENVLPPRK
Download sequence
Identical sequences H0ZEY4
ENSTGUP00000009146 ENSTGUP00000009146 59729.ENSTGUP00000009146

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]