SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000009158 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000009158
Domain Number 1 Region: 1-75
Classification Level Classification E-value
Superfamily CAD & PB1 domains 1.3e-32
Family PB1 domain 0.00026
Further Details:      
 
Domain Number 2 Region: 107-228
Classification Level Classification E-value
Superfamily PDZ domain-like 1.22e-22
Family PDZ domain 0.00000281
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000009158   Gene: ENSTGUG00000008898   Transcript: ENSTGUT00000009257
Sequence length 361
Comment pep:novel chromosome:taeGut3.2.4:2:95052292:95106316:-1 gene:ENSTGUG00000008898 transcript:ENSTGUT00000009257 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QFGAEFRRFSLDRYKPGKFEDFYKLILHIHHIANLEVMIRYADVHGDLLPINNDDNFFKA
VSSAHPLLRVFVQRQDEVDYSNFGTNTLSRKKKALVTLRNDTLRRRPHINISMPHDFRPV
SSIIDVDILPETHRRVRLYRHGCEKPLGFYIRDGTSVRVTPHGLEKVPGIFISRMVPGGL
AESTGLLAVNDEVLEVNGIEVAGKTLDQVTDMMIANSHNLIITVKPANQRNNIIRSSRMS
GSSGQSTDSTASHHSLPTPHVLQNFHPDEMESDEEADIVIEGGLEPQHIPKLHSLTSSSL
SRINGSSLSHRLQRDLVLNNSSGRESNGNIHKLLSSLKTDPRHSLVIPRGGIEEDGTVIT
L
Download sequence
Identical sequences H0ZEZ6
ENSTGUP00000009158 59729.ENSTGUP00000009158 ENSTGUP00000009158

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]