SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000009169 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000009169
Domain Number 1 Region: 241-441
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.97e-50
Family DBL homology domain (DH-domain) 0.00000000725
Further Details:      
 
Domain Number 2 Region: 433-557
Classification Level Classification E-value
Superfamily PH domain-like 4.37e-36
Family Pleckstrin-homology domain (PH domain) 0.0000132
Further Details:      
 
Domain Number 3 Region: 166-237
Classification Level Classification E-value
Superfamily SH3-domain 4.99e-25
Family SH3-domain 0.0000419
Further Details:      
 
Domain Number 4 Region: 3-125
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.000000000162
Family Calponin-homology domain, CH-domain 0.0028
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000009169
Domain Number - Region: 798-854
Classification Level Classification E-value
Superfamily Oxygen-evolving enhancer protein 3, 0.0222
Family Oxygen-evolving enhancer protein 3, 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000009169   Gene: ENSTGUG00000008859   Transcript: ENSTGUT00000009268
Sequence length 862
Comment pep:novel chromosome:taeGut3.2.4:1:24872405:24985327:1 gene:ENSTGUG00000008859 transcript:ENSTGUT00000009268 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSAEQTVTWLIALGVLDSLRKQRTFFELHAQAAIHLNRNFCFLVTVIPPPLLLQVYPEP
RTEGECMSNIREFLRGCGASLRLETFDANDLYQGQNFSKVLSSLVALNKVTADIGLGSDS
VCARPSSHRIKSFDSLGSQSSHSRTSKLFQGQYRSLDMTDNGNHQLVVRAKFNFQQTNED
ELSFSKGDIIHVTRVEEGGWWEGTLNGKTGWFPSNYVREIKSNEKPVSPKSGTLKSPPKG
FDTSAINKSYYNVVLQNILETENEYAKELQTMLSNYLRPLQASEKLTLTNTSYLMGNLEE
ISSFQQMLVQSLEECTKLPEAQQRVGGCFLNLMPQMKSLYLTYCANHPSAVNVLTEHSEE
LGEFMEMKGANSPGILVLTTGLSKPFMRLDKYPTLLKELERHMEDYHPDRPDIQKSMTAF
KNLSAQCQEVRKRKELELQILTEAIRCWEGEDIKTLGNVIYMSQVMIQCAGSEEKNERYL
LLFPNILLMLSASPRMSGFIYQGKLPMTGMTITKLEDSENHKNAFEISGNMIERILVSCN
NQQDLHEWVDHLQKQTKVTTVGNPTIKPHSVPSHTLPSHPVTPSSKHSDSKPIPLTPAYH
TLPHPSHHGTPHTTINWGPLEPPKTPKPWSLSCLRPAPPLRPSAALCYKEDLSKSPKTMK
KLLPKRKPERKPSDEEFALRKSTAALEEDAQILKVIEAYCTSAKTRQTLNSTWQGTDLMH
NHVLADDDQSSLDSLGRRSSLSRLEPSDLSEDSDYDSIWTAHSYRMGSTSRSRKESAPQV
LLPEEEKIIVEETKSNGQTVIEEKSLVDTVYALKDEVQELRQDNKKMKKSLEEEQRARKD
LEKLVRKVLKNMNDPSWDETNL
Download sequence
Identical sequences H0ZF07
ENSTGUP00000009169 ENSTGUP00000009169 59729.ENSTGUP00000009169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]