SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000009200 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000009200
Domain Number 1 Region: 65-140
Classification Level Classification E-value
Superfamily Homeodomain-like 3.89e-23
Family Homeodomain 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000009200   Gene: ENSTGUG00000008938   Transcript: ENSTGUT00000009299
Sequence length 151
Comment pep:novel chromosome:taeGut3.2.4:7:17031441:17032219:1 gene:ENSTGUG00000008938 transcript:ENSTGUT00000009299 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FANDPTVTHTANLKPVKYDHSSLQRSLHSSATLFEVNSCNSSLKEDIKNPVNLNLTVQPS
AVQSCLRPSVQDGLPWCPTQGRSRKKRKPYTKQQIAELENEFLLNEFINRQKRKELSNRL
NLSDQQVKIWFQNRRMKKKRVVMREQALSMY
Download sequence
Identical sequences H0ZF38
ENSTGUP00000009200 ENSTGUP00000009200 59729.ENSTGUP00000009200

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]