SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000009363 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000009363
Domain Number 1 Region: 4-258
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.59e-75
Family PAPS sulfotransferase 0.0000000241
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000009363   Gene: ENSTGUG00000009089   Transcript: ENSTGUT00000009462
Sequence length 259
Comment pep:novel chromosome:taeGut3.2.4:6:20448078:20448857:1 gene:ENSTGUG00000009089 transcript:ENSTGUT00000009462 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GTSRQIPQTIIIGVRKGGTRALLEMLDIHPNIVVAATEVHFFDWDENYVKGIDWYRNLMP
FSYGNQITIEKTPGYFTSPQAPGRIHDMNSSIKLLLILRDPTERVISDYTQVYYNRVESH
KPVQLFEDIVIKNGVLNTKYKAIQRSLYDVHMEKWLKHFSLDQIHIVDGNTLIKDPLPEL
QKVERFLNLPSRIMSSNFYFNQTKGFYCIRSDGRERCLHESKGRPHPLVNSTVLEQLYSY
FREHNAKFYRMVNHSFDWH
Download sequence
Identical sequences A0A091EAX4 A0A091MS79 A0A093PIZ9 H0ZFK1
59729.ENSTGUP00000009363 59729.ENSTGUP00000016102 ENSTGUP00000009363 ENSTGUP00000016102 ENSTGUP00000009363 ENSTGUP00000016102

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]