SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Taeniopygia guttata 69_3.2.4 > ENSTGUP00000009711

Domain assignment for ENSTGUP00000009711 from Taeniopygia guttata 69_3.2.4

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSTGUP00000009711
Domain Number 1	Region: 19-130
Classification Level	Classification	E-value
Superfamily	Spermadhesin, CUB domain	3.93e-30
Family	Spermadhesin, CUB domain	0.00038
Further Details:

Domain Number 2	Region: 224-339
Classification Level	Classification	E-value
Superfamily	Spermadhesin, CUB domain	6.28e-16
Family	Spermadhesin, CUB domain	0.0048
Further Details:

Domain Number 3	Region: 138-176
Classification Level	Classification	E-value
Superfamily	LDL receptor-like module	0.00000000000511
Family	LDL receptor-like module	0.00094
Further Details:

Domain Number 4	Region: 418-456
Classification Level	Classification	E-value
Superfamily	LDL receptor-like module	0.00000000000929
Family	LDL receptor-like module	0.00083
Further Details:

Domain Number 5	Region: 183-224
Classification Level	Classification	E-value
Superfamily	LDL receptor-like module	0.00000000746
Family	LDL receptor-like module	0.0017
Further Details:

Domain Number 6	Region: 379-417
Classification Level	Classification	E-value
Superfamily	LDL receptor-like module	0.000000759
Family	LDL receptor-like module	0.0024
Further Details:

Domain Number 7	Region: 341-378
Classification Level	Classification	E-value
Superfamily	LDL receptor-like module	0.00000471
Family	LDL receptor-like module	0.0021
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Molecular Function	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSTGUP00000009711 Gene: ENSTGUG00000009422 Transcript: ENSTGUT00000009817
Sequence length	603
Comment	pep:known chromosome:taeGut3.2.4:11:18362137:18386677:1 gene:ENSTGUG00000009422 transcript:ENSTGUT00000009817 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	VNLFLTGKIESAVTSLAACSGELEQHTERRGVIYSPSWPSNYPPAINCSWYIQGDHGDMI TISFKNFDLEDSQKCAVDWLMIGPSSKREEYKVCGSSIPPSFISARDHVWIFFHSDASSS GQAQGFRLSYIRGKIGQSVCQSDEFHCANGKCIPSTWKCNSMDECGDNSDEKNCTVPPTD PPSSICPSGMFQCSAGHSTKCLMNELRCNSVKDCGDGSDEDNCPDLSCGKRLGNFYGSFA SPDLFRADHSRSDLRCTWYVDTQDNRHVLLQLDLQLGYNDYVKVYDGIGERGDKLMQTFS HHNNRHSVSVESSKGQLTVSYHARSKSTGHGFNATYQVKGYCLPWEHPCGSDEECFTDKQ HCDGWWHCPNGKDEENCPACQKNEYPCEGNSGLCYSILDRCNNQKNCPDGSDEKNCFTCQ PGNFHCGTNLCIFETWRCDGQEDCQDGSDERNCLVIVPRKVITAALIGSLVCGLLLVIAL GCAFKLYSLRTREYRAFETQMTRLEAEFVRREAPPSYGQLIAQGLIPPVEDFPVYNASQV SVLQNIRTAMRRQMRRHAARRGSSRRRLGRLWGRLFHRPRGRGQIPLLPPARASQTTLGD GII
Download sequence
Identical sequences	H0ZGJ9 ENSTGUP00000009711 ENSTGUP00000009711 59729.ENSTGUP00000009711

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]