SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000009967 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000009967
Domain Number 1 Region: 20-245
Classification Level Classification E-value
Superfamily L domain-like 1.08e-42
Family Ngr ectodomain-like 0.03
Further Details:      
 
Domain Number 2 Region: 608-720
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.45e-29
Family Calponin-homology domain, CH-domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000009967   Gene: ENSTGUG00000009649   Transcript: ENSTGUT00000010074
Sequence length 733
Comment pep:novel chromosome:taeGut3.2.4:9:17119828:17177278:1 gene:ENSTGUG00000009649 transcript:ENSTGUT00000010074 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PGSWSRSLDRALEEAAVSGTLSLSGRKLRDYPRASAANHDLSDTTQADLSRNRLSELPAE
ACHFVSLETLNLYQNCIRYIPEAVLNLQSLTFLNISRNQLSTLPVHLCSLPLKVLIASNN
KLVSIPEEIGQLRQLTELDVSCNEIQTIPPQIGNLESLRDLNVRRNNLVRLPEELAELPL
IRLDFSCNKITTIPVCYRNLRHLQTIMLENNPLQSPPAQICIKGKIHIFKYLNIEACKIA
PDLPDYDRRPMGFGSCHEELYSSRPYGALDSGFNSVDSGDKRWSGNEPTDEFSDLPLRVA
EFTKEQRLRRESQYQENRGSAVVINGGVEHDLDQIDYIDSCATEEEEEEVRQPKCQDSDS
LSSQFMAYIDQRRISNESSPVKPVSIREFQRTENTRQHLHQNRPLPDSPYFLSLSSHHTQ
VPSTESELQRRHIERTRREAQLAALQYEEERMRTKQIQREAVLDFVKQKASLSPQKQSPM
DSECPFPSRRSQHTDDSALLVSLSGLNQESCATTLPSASTFSPVKSDDRSTISPGSPSAQ
TVHLSPPYPGHAAPPSYRNPSQRPESFLFRTAVRDGAKKAVSSSSTCALSPANDSADPRV
RQNSKQREEELELIEQLRKNIESRLKVSLPSDLGAALTDGVVLCHLANHVRPRSVPSIHV
PSPAVPKLTMAKCRRNVENFLEACRRIGVPQEQLCLPLHILEEKGLTQVAVTVQALLELA
PPKQQPLHHLSAV
Download sequence
Identical sequences H0ZHA2
ENSTGUP00000009967 59729.ENSTGUP00000009967 ENSTGUP00000009967

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]