SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000010022 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000010022
Domain Number 1 Region: 1-293
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.37e-97
Family Amylase, catalytic domain 0.0000000000743
Further Details:      
 
Domain Number 2 Region: 294-387
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 2.34e-25
Family alpha-Amylases, C-terminal beta-sheet domain 0.0000111
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000010022   Gene: ENSTGUG00000009714   Transcript: ENSTGUT00000010129
Sequence length 411
Comment pep:novel chromosome:taeGut3.2.4:1A:48829508:48833136:1 gene:ENSTGUG00000009714 transcript:ENSTGUT00000010129 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LENGLARTPPMGWMSWERFRCNVDCQADPRNCISEQLFFEMADRLAEDGWRELGYEYINL
DDCWAAKQRDVAGQLVPDPKRFPRGIKALADYVHARGLKLGIYGDLGIFTCGGYPGTMLE
NVKQDAQTFAAWGVDMLKLDGCYSSAEEQAKGYPEMARALNATGRPIVYSCSWPAYQGGL
PPQVNYTILAEICNLWRNYDDIQDSWDSVLSIVDWFFTNQDVLQPAAGPGHWNDPDMLII
GNFGLSYEQSRSQMALWTVMAAPLLMSTDLRTISPEAKEILQNRLMIQINQDPLGIQGRR
IVKEKYNIEVFVRPLAQAASALVFFSRRTDMPFRYTTSLAKLHFPEDAVYEVQDVYVGKI
IGDLKTADNFSVVINPSGVVMWYLHPKTLPVQPWHVVRQQAPGGGYRPALL
Download sequence
Identical sequences H0ZHF7
59729.ENSTGUP00000010022 ENSTGUP00000010022 ENSTGUP00000010022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]