SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000010354 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000010354
Domain Number 1 Region: 1015-1119
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.03e-30
Family Calponin-homology domain, CH-domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000010354   Gene: ENSTGUG00000010019   Transcript: ENSTGUT00000010464
Sequence length 1121
Comment pep:novel chromosome:taeGut3.2.4:15:11764822:11807204:1 gene:ENSTGUG00000010019 transcript:ENSTGUT00000010464 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKKASRSVGSVPKVPGVNKAQASEKAKPENGSSVSAVTKLSKTGTSASLLKTKSNDDLLA
GMAGGSGVTMTNGVKAKKNSCVSTASSAPGTTMNSLENKPKTIAGTSSTAKRSTSSGNKE
SSSSRERIRDRSRLSQSKKLPLAGQGPSDTVLAKRSRSRTNPESDIRMSKSKSDNQISDR
AALEAKVNDLLTLAKTKDVEILHLRNELRDMRAQLGLNEDNLEGDEKSEEKEAIVVHQPT
DVESTLLQLQEQNTAIREELNQLKNENRMLKDRLNALGFSLEQRLDNSEKLFGYQSLSPE
ITAGNHSDGGGTLTSSVEGSAPGSMEDLLSQDENTLMDNQHSNSMDNLDSECSEVYQPLT
SSDDALDAPSSSESEGVPSIERSRKGSSGNASEVSVACLTERIHQMEENQHSTAEELQAT
LQELADLQQITQELNSENERLGEEKVILMESLCQQSDKLEHFSRQIEYFRSLLDEHHISY
VIDEDMKSGRYMELEQRYMELAENARFEREQLLGVQQHLSNTLKMAEQDNKEAQEMIGAL
KERNHHMERIIESEQKSKTALASTLEEYKATVASDQIEMNRLKAQLEHEKQRVAELYSIH
NSGDKSDIQDLLESVRLDKEKAETLASGLQEELAHTRNDANRLQDALAKVEDEYRVFQEE
AKKQIEDLNMTLEKLRTELDEKETERSDMKETIFELEDEVEQHRAVKLHDNLIISDLENT
VKKLQDQKHDMEREIKNLHRRLREESAEWRQFQADLQTAVVIANDIKSEAQEEIGDLKRR
LHEAQEKNEKLTKELEEIKSRKQEEERGRVYNYMNAVERDLAALRQGMGLSRRSSTSSEP
TPTVKTLIKSFDSASSQVPSPAAATIPRTPLSPSPMKTPPAAAVSPMQRHSISGPISASK
PLATLTDKRPSYAEIPVQEHLLRTSSTSRPASLPRVPAMESAKSISVSRRSSEEIKRDIS
APDGASPASLMAMGTTSPQLSLSSSPTASVTPTTRSRIREERKDPLSALAREYGGSKRNA
LLKWCQKKTEGYQNIDITNFSSSWNDGLAFCAVLHTYLPAHIPYQELNSQDKRRNFTLAF
QAAESVGIKSTLDINEMVRTERPDWQNVMLYVTAIYKYFET
Download sequence
Identical sequences H0ZID7
59729.ENSTGUP00000010354 ENSTGUP00000010354 ENSTGUP00000010354 XP_002196744.2.42559

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]