SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000010751 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000010751
Domain Number 1 Region: 966-1093,1125-1331
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.53e-78
Family p120GAP domain-like 0.00019
Further Details:      
 
Domain Number 2 Region: 35-198
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.5e-36
Family Calponin-homology domain, CH-domain 0.0000273
Further Details:      
 
Domain Number 3 Region: 1556-1653
Classification Level Classification E-value
Superfamily RGC domain-like 2.48e-33
Family RGC domain 0.00000195
Further Details:      
 
Domain Number 4 Region: 630-831
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000242
Family Motor proteins 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000010751   Gene: ENSTGUG00000010390   Transcript: ENSTGUT00000010864
Sequence length 1653
Comment pep:known chromosome:taeGut3.2.4:10:20751011:20802706:1 gene:ENSTGUG00000010390 transcript:ENSTGUT00000010864 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAEDVDGLAVSRPHYGSVLDNERLTAEEMDERRRQNVAYEYLCHLEEAKRWMEACLNEE
LPATTELEEGLRNGVYLAKLGNFFSPKVVSVKKIYDREQTRYKATGLHFRHTDNVIQWLN
AMSEIGLPKIFYPETTDIYDRKNMPRCIYCIHALSLYLFKLGLPQIQDLYGKVDFTEEEI
SNMRLELEKYGIQMPAFSKIGGILANELSVDEAALHAAVIAINEAIDRQVPADTLTAMKN
PNAMLINLDDQLESTYQATLYRAKQDKMENAKNRVAHSDRERDVYEELLTQAEIQGNINK
VNTHAAISKIDLALERGDALALYEALATPALGLRGLLRENCDWYFKQFLSDRQQKQEAGL
TGPLQKEELQLGVDAANRAAQQYQKRLAAVAKINSAIRMGDAEKTVAEIMNPEAQLPEVY
GFAADLYQRELATLQQQSPEGHLTHPELSVAVEMLSSVALINRALASGDMNTVWKQLSSP
VTGLTNVEDENSQRYIDDLVKLKAERSAEGNEFITWNDIQSCVDHVNKVVHEEHERILAI
GLINEALDEGDTKKTLQALQTPAAKLEGVAPKVAQHYQDTLLRAKREKAQDTQDETAVLW
LDEIQDGIHKANKDTEESQRFSLGILAINEAVDHGDVSQTLSALRSPDVGLYGVTPECAE
TYQQELSEVKKRAAGGNGSDWVKHWVRGGYHYYHNLRTKDGGWDEPAEFVQNDTQLSREE
IQSTISGVTAAYNREQLWLANESLIMKLQACCRGYLVRQEFNSRINFLKKQVPAITCIQS
QWRGYKQRKAYQIRLDYLRAQKDQVVKIQSMTRMYQARRRYRDRLQYFRNHINDVVKIQA
FIRANKAREDYKTLINAENPPMAVVRKFVHLLDQSDQDFQEELELMKLREEVVTLIRSNQ
QLENDLNLMDIKIGLLVKNKITLQDVVSHSKKLTKKNKEQLSDMMMLNKQRGGLKALSKE
KREKLEAYQHLFYLLQTNPTYLAKLIFQMPQNKSTKFMDSVIFTLYNYASNQREEYLLLR
LFQTALQEEIKSKVDQIHEIVTGNPTVIKMVVSFNRGARGQNALRQILAPVVKEIIDDKS
LNIKTDPVDIYKSWVNQMESQTGEASKLPYDVTPEQALSHEEVRTRLDASIRNMRTVTDK
FLSAIISSVDKIPYGMRFIAKVLKDSLHEKFPDAGEDELLKIVGNLLYYRYMNPAIVAPD
AFDIIDLSAGGQLTTDQRRNLGSIAKMLQHAASNKMFMGDNAHLSIINEYLLQSYQKFRR
FFQAACEVPELQDKFNIDEYSDLVTLTKPVIYISIGEIINTHTLLLDHQDAIAPEHNDPI
HELLDDLGEVPTIESLIGEGSGNVNDPNREMLAKTEVSLTLTNKFDVPGDENAEMDARTI
LLNTKRLIVDVIRFQPGETLTEILETSATSEQEAEHQRAMQKRAIRDAKTPDKMKKSVSV
KEDGNLNLQEKKEKIKAGLKKLTELGPVNAKNKYQELINDIAKDIRNQRRYRQRRKAELV
KLQQTYSALNSKATFYGEQVDYYKSYIKTCLDNLASKGKVSKKPREMKGKNSKKISLKYT
AARLHEKGVLLEIEDLQGNQFKNVIFEISPTEEVGDFEVKAKFMGVQMETFMLHYQDLLQ
LQYEGVAVMKLFDRAKVNVNLLIFLLNKKFYGK
Download sequence
Identical sequences H0ZJI3
ENSTGUP00000010751 59729.ENSTGUP00000010751 ENSTGUP00000010751

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]