SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000010782 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000010782
Domain Number 1 Region: 21-259
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.83e-86
Family Calponin-homology domain, CH-domain 0.0000277
Further Details:      
 
Domain Number 2 Region: 277-399
Classification Level Classification E-value
Superfamily Spectrin repeat 2.36e-34
Family Spectrin repeat 0.000000247
Further Details:      
 
Domain Number 3 Region: 513-634
Classification Level Classification E-value
Superfamily Spectrin repeat 2.75e-31
Family Spectrin repeat 0.000000886
Further Details:      
 
Domain Number 4 Region: 400-508
Classification Level Classification E-value
Superfamily Spectrin repeat 6.41e-24
Family Spectrin repeat 0.00000114
Further Details:      
 
Domain Number 5 Region: 742-870
Classification Level Classification E-value
Superfamily EF-hand 2.03e-22
Family EF-hand modules in multidomain proteins 0.007
Further Details:      
 
Domain Number 6 Region: 638-749
Classification Level Classification E-value
Superfamily Spectrin repeat 4.61e-22
Family Spectrin repeat 0.000000799
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000010782   Gene: ENSTGUG00000010436   Transcript: ENSTGUT00000010895
Sequence length 897
Comment pep:novel chromosome:taeGut3.2.4:3:45260083:45328023:1 gene:ENSTGUG00000010436 transcript:ENSTGUT00000010895 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSMNQIETNMQYTYNYEEDEYMTQEEEWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGT
QIENIEEDFRNGLKLMLLLEVISGERLPKPDRGKMRFHKIANVNKALDYIASKGVKLVSI
GAEEIVDGNVKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYRNVNIQNFH
LSWKDGLGLCALIHRHRPDLIDYSKLNKDDPIGNINLAMEIAEKHLDIPKMLDAEDIVNT
PKPDERAIMTYVSCFYHAFAGAEQAETAANRICKVLAVNQENERLMEEYERLASELLEWI
RRTIPWLENRTPEKTMQAMQKKLEDFRDYRRKHKPPKVQEKCQLEINFNTLQTKLRISNR
PAFMPSEGKMVSDIAGAWQRLEQAEKGYEEWLLNEIRRLERLEHLAEKFRQKASTHEQWA
YGKEQTLLQKDYESASLTEVRAMLRKHEAFESDLAAHQDRVEQIAAIAQELNELDYHDAA
SVNDRCQKICDQWDSLGTLTQKRREALERTEKLLETIDQLHLEFAKRAAPFNNWMEGAME
DLQDMFIVHSIEEIQSLISAHDQFKATLPEADGERQAILSIQNEVEKVIQSYSMRISATN
PYSTVTVEEIRSKWEKVKQLVPQRDQSLQEELARQHANERLRRQFAAQANVIGPWIQTKM
EEIARSSIEMTGPLEDQMNQLKQYEHNIINYKHNIDKLEGDHQLIQEALVFDNKHTNYTM
EHIRVGWELLLTTIARTINEVETQILTRDAKGITQEQMNDFRASFNHFDRRKNGLMDHDD
FRACLISMGYDLGEAEFARIMSLVDPNGQGTVTFQSFIDFMTRETADTDTAEQVIASFRI
LASDKPYILADELRRELPPEQAQYCIKRMPPYTGPGSVPGALDYTSFSSALYGESDL
Download sequence
Identical sequences H0ZJL3
ENSTGUP00000010782 ENSTGUP00000010782 XP_005423248.1.5688 XP_005487631.1.73095 XP_021382757.1.53032 59729.ENSTGUP00000010782

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]