SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000010813 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000010813
Domain Number 1 Region: 2-104
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.71e-32
Family Calponin-homology domain, CH-domain 0.0000675
Further Details:      
 
Domain Number 2 Region: 186-214
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000223
Family LIM domain 0.014
Further Details:      
 
Domain Number 3 Region: 155-185
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000345
Family LIM domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000010813   Gene: ENSTGUG00000010485   Transcript: ENSTGUT00000010926
Sequence length 876
Comment pep:novel chromosome:taeGut3.2.4:1A:50823080:50842793:-1 gene:ENSTGUG00000010485 transcript:ENSTGUT00000010926 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PRGALKAWCRRQCEGYRGVEIRDLSTSFRDGLDFCAILHRHRPDLLDFDSLSKDDVYENN
RLAFELAERELGIPALLDPNDMVSMKVPDRLSIMTYVSQYYNHFNNPSQASVPLPMKRPA
AASPPLLSQKTPVAAIESPSAPQDDPPSERSQRSTLSSTCAACQQHVHLVQRYLAEGKLY
HRQCFRCKECSSTLLPGSYKPGSEAGTFVCTQHRGKLAVSGKAERRPSLDRQSPEESVAE
TSTPAEGLAGPAEKDSTASKAETPTPPAHAGSGPPVSQTPPRPPIPSKPAGLTQDKASSL
DGRRPTPAPRKATDGSALSPPTSHPVPRPRSTLQGEGSECGPGMVNGRLPETSPPVPKPR
GRPCSSDRGGAAARAKDPPWMALVQAEPKKKPAPPPPPGNSHETPSRTSEEEDGEEVRKA
RSEESRSDSAEPKPYNPFEEEDEEEVESADTQKSTPEQEQSETAAKPLHPWYGITPTSSP
KAKKRPAPRAPNASPLAHHPISRLSHSEPSSSTPSPALSLESINSESSAKVLGDTDEASV
PKSSSEPTVHMPAESPAVPASLSTNSSFSSSSELASLSGETQPSTLHTSRSISTGSLKAS
PSQLPPKPPAGASPTPILLASDGGAGSPKTSSSPKPQLKSSCKENPFNRKPSPAASPSAK
KPPKGSKPVRPPAPGHGFPLIKRKVQTDQYIPEENIYGEMDAIEHQLDELEHRGVALEEK
LRSAENDNPEDSLLVDWFKLIHEKHMLVRHESELIYIFKQQNLEQRQSDVEYELRCLLNK
PVEKDWTDEDRGREKVLMQELVTIIEQRNAIVNCLDEDRQREEEEDKMLEAMIKRKEFHK
ETETESKKKGKFKPMKVLKLLGNKHDSKSKSPKEKS
Download sequence
Identical sequences H0ZJP4
ENSTGUP00000010813 59729.ENSTGUP00000010813 ENSTGUP00000010813

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]