SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000011037 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000011037
Domain Number 1 Region: 4-142
Classification Level Classification E-value
Superfamily PX domain 4.71e-36
Family PX domain 0.00000118
Further Details:      
 
Domain Number 2 Region: 237-338
Classification Level Classification E-value
Superfamily CAD & PB1 domains 1.2e-25
Family PB1 domain 0.0000153
Further Details:      
 
Domain Number 3 Region: 170-233
Classification Level Classification E-value
Superfamily SH3-domain 7.09e-18
Family SH3-domain 0.00067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000011037   Gene: ENSTGUG00000010694   Transcript: ENSTGUT00000011156
Sequence length 350
Comment pep:novel chromosome:taeGut3.2.4:1A:51387662:51397676:-1 gene:ENSTGUG00000010694 transcript:ENSTGUT00000011156 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLPRQLRDKSDFDQLPDDVPVSANIADIEEKKGFTNYYMFVIEVKLKGGGRYLIFRRYR
EFYALHTKLEQRYGPESNNSPFTCTLPVLPGKVFVGAKKEIAENRIPILNVYMKNLLCLP
AWVLMDEDVRLFFYHSTFDGEQVPHRLRRLRPRTRRVKSISDQVPVFDRTAAPRAEALFD
FPGTNKLELRFKKGDLIYLLSKVNKDWLEGTADGATGIFPCAFVKIIKDLPQQEDTVNKV
RCYYYDETVSTIRDISVEEDLNSIPLFKDLMELMRQEFNQDDIVLNYRDPDGDLIRLLSD
QDVELMVSQSRGSPSEKHFFPWKLHITHKDDLGVYNTSPGTGATQTVGAM
Download sequence
Identical sequences H0ZKB7
ENSTGUP00000011037 XP_002196236.2.42559 59729.ENSTGUP00000011037 ENSTGUP00000011037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]