SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000011063 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000011063
Domain Number 1 Region: 208-330
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.14e-34
Family Calponin-homology domain, CH-domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000011063   Gene: ENSTGUG00000010726   Transcript: ENSTGUT00000011183
Sequence length 341
Comment pep:novel chromosome:taeGut3.2.4:15:14275869:14283229:-1 gene:ENSTGUG00000010726 transcript:ENSTGUT00000011183 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ERRSKLNVEELSKIEDEDVLDKMLDRTTDFEERRLIRNAMRELRQRKRDQREKERDQRLQ
KREASCDRKGCHATETTTRSTQSADGSARSTVTKTERLVQSSDGTKTSRTTTMESSYVKK
SDNGNRTFVQTKSSYSSSSKKTGSIFDREDESASRQSSLAALERRQAEKKKELMKAQSLP
KTSASQARKAMMEKLQKEGGSSNPAASQTAVQRSSSFGVPNANSIKQMLLDWCRAKTRGY
EHVDIQNFSSSWSDGMAFCALVHNFFPDAFDYSKLTPQNRRQNFEVAFSSAETLVDCVPL
VEVEDMMIMGKKPDAKCVFTYVQSLYNHLRRHELRMRQKEC
Download sequence
Identical sequences H0ZKE3
ENSTGUP00000011063 ENSTGUP00000011063 59729.ENSTGUP00000011063

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]