SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000011138 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000011138
Domain Number 1 Region: 17-251
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 6.89e-80
Family Calponin-homology domain, CH-domain 0.000000633
Further Details:      
 
Domain Number 2 Region: 310-418
Classification Level Classification E-value
Superfamily Spectrin repeat 1.16e-19
Family Spectrin repeat 0.0031
Further Details:      
 
Domain Number 3 Region: 494-634
Classification Level Classification E-value
Superfamily Spectrin repeat 2.49e-19
Family Spectrin repeat 0.0059
Further Details:      
 
Domain Number 4 Region: 425-526
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000641
Family Spectrin repeat 0.0032
Further Details:      
 
Domain Number 5 Region: 959-1056
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000374
Family Spectrin repeat 0.0094
Further Details:      
 
Domain Number 6 Region: 870-1001
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000216
Family Spectrin repeat 0.0072
Further Details:      
 
Domain Number 7 Region: 689-792
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000353
Family Spectrin repeat 0.0055
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000011138
Domain Number - Region: 801-903
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0227
Family Spectrin repeat 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000011138   Gene: ENSTGUG00000010792   Transcript: ENSTGUT00000011258
Sequence length 1057
Comment pep:novel chromosome:taeGut3.2.4:3:49420706:49526062:-1 gene:ENSTGUG00000010792 transcript:ENSTGUT00000011258 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARFSEQEEGPGGGHSEFSDIIKSRSDEHNDVQKKTFTKWINARFSKSGKAPVKDMFTDL
KDGRKLLDLLEGLTGKPLPKERGSTRVHALNNVNRVLQVLHQNNVELVNIGGTDIVDGNH
KLTLGLLWSIILHWQVKDVMKNIMSDLQQTNSEKILLSWVRQSTRPYSQVNVLNFTTSWA
DGLAFNAVIHRHKPELFSWDRVTKMSPVERLENAFNIAKNHLGIEKLLDPEDVAVQIPDK
KSIIMYLTSLFEVLPKQVTMEDIREVETLPRRYKQECEDGEFKILTVALEEDQDSSRAET
PSTVTEVDMDLDSYQVALEEVLTWLLSAEDAFREQEEISGDVEEVKEQFSTHEGFMMELT
AHQSSVGNVLQAGNQLVAQGSLSPEEEFEIQEQMLLLNSRWEELRVESMDRQSRLHDMLM
ELQKQQLQQLSDWLTVTEERIQKMESQLLAEDLESLQKQLEEHKSLQSDLEAEQVKVNSL
THMVVIVDESSGESATAILEEQLQRLGERWTAVCRWTEDRRVKLQEIQLLWQELLEEQCL
LKAWLTEKEEALSKVQTSNFRDQTDLSVNVRKLAILKEDMGMKRQTLDQLNELGQDVAQI
LGNGKASSKIDQDQEELTQRWDSLVQKLEDYSNQVTQAVGNIGMSQVSQKTTAETPLKEQ
VVVKQSRQELPPPPLPKKRQIPGDSEAKKKFDAESTELLNWISKSKSAIQATDIKEYKKM
RETSSMKEKLKVIEKERAEKNQKLDELKRSGHILLDQMGKEGLPTVDITSVMEKILSGWK
DVVQNLEEVARKIKYQEDINAYLKEMNELEKTLIEKDDWLKNYSSSASQSSAVLKELCQQ
ELTHLVSLSPQLEHLKATCKTLTSQPMPPNFIQENLSGFLDHFKLTRQKLEECHQQLKKE
TERQPSREYVESLQQLKDALSELEGKQLSIASGLSEPSKVENALQQAKTVCETLEAQKPR
VDKLAEETKALEKHASSEVKNTYMQEFKDVQGHWDKLKLKISKDVKLLEEIVPKLRIFET
DSKVVQKWMDGVKDFLMTEKAVQGDTEGLQRQLDQCT
Download sequence
Identical sequences H0ZKL7
ENSTGUP00000011138 ENSTGUP00000011138 59729.ENSTGUP00000011138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]