SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000011318 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000011318
Domain Number 1 Region: 6-247
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.78e-76
Family Calponin-homology domain, CH-domain 0.0000203
Further Details:      
 
Domain Number 2 Region: 2507-2657
Classification Level Classification E-value
Superfamily Spectrin repeat 2.88e-32
Family Spectrin repeat 0.00045
Further Details:      
 
Domain Number 3 Region: 266-388
Classification Level Classification E-value
Superfamily Spectrin repeat 7.72e-31
Family Spectrin repeat 0.00022
Further Details:      
 
Domain Number 4 Region: 2713-2867
Classification Level Classification E-value
Superfamily Spectrin repeat 9.82e-30
Family Spectrin repeat 0.00092
Further Details:      
 
Domain Number 5 Region: 2835-2972
Classification Level Classification E-value
Superfamily Spectrin repeat 2.75e-28
Family Spectrin repeat 0.00033
Further Details:      
 
Domain Number 6 Region: 1454-1596
Classification Level Classification E-value
Superfamily Spectrin repeat 8.92e-28
Family Spectrin repeat 0.0007
Further Details:      
 
Domain Number 7 Region: 2080-2228
Classification Level Classification E-value
Superfamily Spectrin repeat 3.27e-26
Family Spectrin repeat 0.00072
Further Details:      
 
Domain Number 8 Region: 1264-1384
Classification Level Classification E-value
Superfamily Spectrin repeat 5.28e-25
Family Spectrin repeat 0.00038
Further Details:      
 
Domain Number 9 Region: 2932-3080
Classification Level Classification E-value
Superfamily Spectrin repeat 4.32e-24
Family Spectrin repeat 0.0012
Further Details:      
 
Domain Number 10 Region: 1144-1279
Classification Level Classification E-value
Superfamily Spectrin repeat 9.81e-23
Family Spectrin repeat 0.00084
Further Details:      
 
Domain Number 11 Region: 3245-3393
Classification Level Classification E-value
Superfamily Spectrin repeat 2.4e-22
Family Spectrin repeat 0.0016
Further Details:      
 
Domain Number 12 Region: 1680-1807
Classification Level Classification E-value
Superfamily Spectrin repeat 1.32e-21
Family Spectrin repeat 0.00094
Further Details:      
 
Domain Number 13 Region: 664-781
Classification Level Classification E-value
Superfamily Spectrin repeat 2.7e-21
Family Spectrin repeat 0.001
Further Details:      
 
Domain Number 14 Region: 3083-3188
Classification Level Classification E-value
Superfamily Spectrin repeat 3.66e-21
Family Spectrin repeat 0.0012
Further Details:      
 
Domain Number 15 Region: 1601-1703
Classification Level Classification E-value
Superfamily Spectrin repeat 1.87e-20
Family Spectrin repeat 0.00038
Further Details:      
 
Domain Number 16 Region: 1865-2020
Classification Level Classification E-value
Superfamily Spectrin repeat 4.65e-19
Family Spectrin repeat 0.0021
Further Details:      
 
Domain Number 17 Region: 554-680
Classification Level Classification E-value
Superfamily Spectrin repeat 3.26e-18
Family Spectrin repeat 0.0013
Further Details:      
 
Domain Number 18 Region: 2335-2452
Classification Level Classification E-value
Superfamily Spectrin repeat 8.52e-18
Family Spectrin repeat 0.00077
Further Details:      
 
Domain Number 19 Region: 850-963
Classification Level Classification E-value
Superfamily Spectrin repeat 4.58e-16
Family Spectrin repeat 0.0036
Further Details:      
 
Domain Number 20 Region: 2233-2342
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000417
Family Spectrin repeat 0.0029
Further Details:      
 
Domain Number 21 Region: 1022-1132
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000755
Family Spectrin repeat 0.003
Further Details:      
 
Domain Number 22 Region: 385-496
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000768
Family Spectrin repeat 0.00079
Further Details:      
 
Domain Number 23 Region: 3372-3460
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000196
Family Spectrin repeat 0.00094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000011318   Gene: ENSTGUG00000010970   Transcript: ENSTGUT00000011442
Sequence length 3460
Comment pep:novel chromosome:taeGut3.2.4:5:24148310:24249939:-1 gene:ENSTGUG00000010970 transcript:ENSTGUT00000011442 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VTMGTEYEKDHIKKLQEQRMSMQKKTFTNWMNNVFSRNNVKIEIEDIYTDLKDGISLMKL
LELLSGEDLPKPSRGKMRVHFLENNSKAITFLKSKVQVKVIGPENIVDGDRTLILGLIWI
IILRFQISSIKLDKEEFGGRADVLFANEALLLWCQHKTASYSNVSVKDFSKSWSDGLAFN
ALIHAHRPDLIHYSSLRQDQPIKNLNNAFDVAEKEFGISKLLDAEDVAVPYPDERSIMTY
VSLYYHYFSRLKQGQTIQKRLNKIVFFLKEIDDLKFQYEQMVSDLLKWIKQKVMELDDRH
FPNSLQEMWLLMANFKTFRTVEKPPKYQEKGMIEAHLFNIRTKQRANNQRPYLPPEGKML
QDVEKHWIILEKSEHNRGKALQKEMLRLERLEQLAQRFLKKAALRESYLEDMRKVIGKQD
FWPESVDRMEAASRKLEAIVADVLPRKERFTALDEMATVISQENYHSKDRILHKQKSISK
QWQDLLDQLQRREQSLGIMQEILGLLRDIDAIAEELKELQVLVNSQDCGKQLLEVVDLLQ
NHNLVDSQISSYDDRLTHITQRTGEISKDSTVKSELLYAKVQMLHQLYQNLTAQSKSRKS
QLEEALKLFEFFRDCKEEESWISEKWKLARMTTLGKDVSQITASIQKNKALEAECNSHRA
ICTDVMRRGWELSQKNPMHQDSILRQTDNLQKLWQQLQDEVADRKSRLQAAALIKQYFAD
VDEADSWLRERQPLLASKDYGKDESSAEALLHRHLRLEKEIAAYSSEMRRLKEQADIAAQ
QAPAAVSRGGIVSHCFEERKQNNWGKFVAHLVIFYVFKPLLLWKKYCDLKISCSVLFQKF
LGKLLIKSSSLLQNRKKALEEMIGYYRFCSSCEEFQSWMRDKENIFRTLQPQADNVEVMQ
QKYQRFLTELAAGKGQLEDIENLAVKYGKISPSKYFEIQTWMEKINIRWQSMETLKEEKG
SELIGVADVRTFLQDCQSIGVLLQDKMVQLRDLEPGNFPAGLESDKRKLYTIEREVLVTE
RKIEYLRSVAKSIKDTNPAESRAITEQVENMERLLAELKLEIQKKQDILQWAQNQQSFLQ
DSRRLLLWAEGIREKLSSEEMGLDVGSAEQLLKEHQDLLIEIGSQNESLKHVSLNHKTAA
LCSASRDVHQTMERLAKEKKELEEMWEKRWEKLQDGLELQKFNREGDRINAALSGHEAFL
RGHDLGDHVDAVRSLLKQHQEFEQLLMALKRRVEALNENGVKLLESRHFASHVIEERMVT
LRRRWEQLIQSNAKRKQRLLDSLQLQEFNRDAAELLIWMEEKYKIASDESYRDPTNVLRK
LKWHEAAEKEMLANEEHFTTLIKKGNKLVQDNHYAAVSVQEKMSELKKKWRELYGKMIER
GDKLRQAGQQEQLMELLQDAKKKIEKIEKVLQESETGHDLRSSRDLLKQHRQLENETREL
AEKMNAIVSHARKMATNHFDSQRILDETQKYLKRFESLQAPLYERHNLLEAAVDLYEFYH
YHDMELNWINERLPIAHSTKCGKSLDVAQNLLQKHKELQAEVNAHKQQVQRILDKGKTMI
VGQHPSAQKISEKCQELLTAWQGLEKSCEERMKQLQHSVGFQEFLMTTSDLEAWIAEKYP
LVTSKDYGKDEDGTLKLIKKHKALEHEIAIYQDLLKELSESAQTLPLVGSIEYIEVDAPK
EQVHSRLQELQELAAARGKKLDQTLVLHEFLREYEDLEDWITQQKQTASSEDYGNYYEHV
LQLCAKYDTFRHQLEAAGKRVVAFQQLADNLLNQGYSESWEIRQMQKQLRNSWEELLEMT
RLRGVQLRDAEVIHKCYQDLTDALAHIEEKSKSIPDDVAKDMTGVQTQLRNHVALEHELS
GNEQQLQELIHSADLVLPHCSQKQVEDLKAKQQAIVTSWRALKAKVEQRRRLLEQAYKLY
EFQAHVWDYFLWTAEIIREMRAKESIRDISTSSLRLTQHQQLLAEIEAREEKYSNVVQLG
QSLLQDEEMPSKEIQQKLQALSEEKKNVYNAWRQKKEWLEKIHQEQMFYKDWDHLDMLLN
SQEVYLKSNDLGRSVDEVEQLIRKHEAFEKLLASQDEKEASRLEKADALEGQKIQHKLNV
IHERKRQIKDLSQTRREKLQTALLLALFYQNLEEAEDWISERMQKLEDPSIQDPSNLQDK
MKLLQKHQVFEAEILANEEIIIAVNKKGEALISKGHPKSGEIRRQVRMLQEHWEKLKRAV
AARGKMLEDSRDFLEFLQKVDQVEAWIREKAKVMINVGDVGNDYEHCLQLKKKLNEFRGA
TSGSTVDDAHIRTINALAMKLERQNKEETKTIYERRKQLNEKWNSFHGNLNAYRKKLEGA
LEIHALIREIDDITERITEKSVLIQALDYGKDVESVENLIRRHEEMEREISVIKSKMEPL
ELESFRLSTRNPSINDKLTMKQQEMKNNWLRLQGQAKQRKEKLEASYQLQKFNLEMKEIL
DWAQNTRALMEAGGLPKSVNEAESMIEEHQERKAKITYILKKLSLGLDYGKELGNSGHYA
TPEIRQSLSRLQQAWSELIQAWKEQYIKLFQAQDLQKFYGYVEQIESWLSSKEAFLANED
LGDSVSSVESLQRKHTQFEKALEAQMEKIDEMASFAQQLIQNKHYDSENISSRCQAVLRR
KKRLLENAAARRHLLEESRLLQKFLKNSFEVAAWINEKNSIAQDDSWKDPSNLQTKLQRH
QAFQAEIMANRNRLDSIKSEGEKMLHERHYAPEAIQSRLQEMEELWEELLASCQDKWTKL
QDAYKGLHFQRNVEDTEKWLEGVENDLKAPYNDNDLVVLNSHLKKQEELEEDIAAHRDRL
QELVVTAQQFQKEKHFLADELEEKVDELVQRYKRLHDPLQERRGSLEASRLQYQFFRDVD
EELAWVREKLPVASSKDYGKSLVTIQSLQEKHQNLENEINSRDALTKAVIITGQKLVRGG
HSASRKIIEQLKELETSVETLKAEAQERRQRLMQSYEAHLFLNELLEVEAWLAERSFILE
TSDYGKNEESTQVLLRKLEATKLDMDSFRLRIEKVQETGASLINKNSPESSVILSKLQGI
LADYQSLLQKFDTQRKRLQEQFQLYQFEREFQLVDAWLSSKLSVAESDDYGQDLDDVEVL
EKKFKDFVSEMKPLGHSKVVSLNELASKLDKEGHSKMDVIQKRTKQINEMWEKLCNAVEI
RTENLRAAHQVHQYDHDVDEVKGWMQEKEAVVDIEDYGYDLPGVQTLLSHLEGVERDLGV
IMKELERIRGDAWHLSRTYPQVKENIMERLTDVDECWENLDKKFLERKARLSQAEQVQVY
FNDCRELMAWANEMHALVISEELANDVLGAELLIKRHEEYKREIEKQWLKYEEMQRAGGD
LMKNGHFMSVEIEEKLLELSELMKKVKESWDMRKVLYEENWEIQLLRRELEQAEAWLAAK
ESFLSDPSYGDSVSEVEELLKKHHDFEKMLAAQEEKFAQL
Download sequence
Identical sequences H0ZL45
59729.ENSTGUP00000011318 ENSTGUP00000011318 ENSTGUP00000011318

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]