SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000011593 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000011593
Domain Number 1 Region: 1-120,151-258
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.92e-76
Family Calponin-homology domain, CH-domain 0.0000321
Further Details:      
 
Domain Number 2 Region: 8385-8527
Classification Level Classification E-value
Superfamily Spectrin repeat 5.13e-21
Family Spectrin repeat 0.0032
Further Details:      
 
Domain Number 3 Region: 8036-8191
Classification Level Classification E-value
Superfamily Spectrin repeat 9.41e-21
Family Spectrin repeat 0.0043
Further Details:      
 
Domain Number 4 Region: 7816-7940
Classification Level Classification E-value
Superfamily Spectrin repeat 1.94e-19
Family Spectrin repeat 0.0029
Further Details:      
 
Domain Number 5 Region: 7072-7207
Classification Level Classification E-value
Superfamily Spectrin repeat 7.85e-19
Family Spectrin repeat 0.0099
Further Details:      
 
Domain Number 6 Region: 6949-7090
Classification Level Classification E-value
Superfamily Spectrin repeat 4.97e-18
Family Spectrin repeat 0.0049
Further Details:      
 
Domain Number 7 Region: 3312-3434
Classification Level Classification E-value
Superfamily Spectrin repeat 6.8e-18
Family Spectrin repeat 0.006
Further Details:      
 
Domain Number 8 Region: 2658-2783
Classification Level Classification E-value
Superfamily Spectrin repeat 9.6e-17
Family Spectrin repeat 0.0093
Further Details:      
 
Domain Number 9 Region: 1600-1739
Classification Level Classification E-value
Superfamily Spectrin repeat 1.14e-16
Family Spectrin repeat 0.0048
Further Details:      
 
Domain Number 10 Region: 3096-3221
Classification Level Classification E-value
Superfamily Spectrin repeat 5.04e-16
Family Spectrin repeat 0.0044
Further Details:      
 
Domain Number 11 Region: 6738-6878
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000157
Family Spectrin repeat 0.0088
Further Details:      
 
Domain Number 12 Region: 4268-4424
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000011
Family Spectrin repeat 0.008
Further Details:      
 
Domain Number 13 Region: 4487-4643
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000205
Family Spectrin repeat 0.0066
Further Details:      
 
Domain Number 14 Region: 2440-2579
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000136
Family Spectrin repeat 0.0061
Further Details:      
 
Domain Number 15 Region: 5070-5192
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000156
Family Spectrin repeat 0.0057
Further Details:      
 
Domain Number 16 Region: 7277-7395
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000627
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 17 Region: 3868-3972
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000158
Family Spectrin repeat 0.0029
Further Details:      
 
Domain Number 18 Region: 7946-8054
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000016
Family Spectrin repeat 0.0096
Further Details:      
 
Domain Number 19 Region: 538-676
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000324
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 20 Region: 1384-1520
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000667
Family Spectrin repeat 0.0088
Further Details:      
 
Domain Number 21 Region: 8489-8637
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000106
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 22 Region: 3546-3678
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000119
Family Spectrin repeat 0.0069
Further Details:      
 
Domain Number 23 Region: 7604-7747
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000127
Family Spectrin repeat 0.014
Further Details:      
 
Domain Number 24 Region: 3794-3903
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000144
Family Spectrin repeat 0.0041
Further Details:      
 
Domain Number 25 Region: 7402-7535
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000144
Family Spectrin repeat 0.0078
Further Details:      
 
Domain Number 26 Region: 5910-6048
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000088
Family Spectrin repeat 0.0095
Further Details:      
 
Domain Number 27 Region: 2228-2382
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000396
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 28 Region: 3954-4113
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000164
Family Spectrin repeat 0.0068
Further Details:      
 
Domain Number 29 Region: 1049-1204
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000054
Family Spectrin repeat 0.015
Further Details:      
 
Domain Number 30 Region: 5692-5809
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000916
Family Spectrin repeat 0.0074
Further Details:      
 
Domain Number 31 Region: 2808-2913
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000144
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 32 Region: 1710-1847
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000181
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 33 Region: 3006-3121
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000313
Family Spectrin repeat 0.0044
Further Details:      
 
Domain Number 34 Region: 4598-4751
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000366
Family Spectrin repeat 0.022
Further Details:      
 
Domain Number 35 Region: 2066-2177
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000042
Family Spectrin repeat 0.0092
Further Details:      
 
Domain Number 36 Region: 5457-5576
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000128
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 37 Region: 1286-1383
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000144
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 38 Region: 1532-1636
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000158
Family Spectrin repeat 0.0051
Further Details:      
 
Domain Number 39 Region: 1958-2058
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000017
Family Spectrin repeat 0.0062
Further Details:      
 
Domain Number 40 Region: 4937-5034
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000236
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 41 Region: 6533-6623
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000266
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 42 Region: 6350-6462
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000301
Family Spectrin repeat 0.015
Further Details:      
 
Domain Number 43 Region: 3226-3324
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000576
Family Spectrin repeat 0.0097
Further Details:      
 
Domain Number 44 Region: 5581-5672
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000196
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 45 Region: 3439-3538
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000366
Family Spectrin repeat 0.0091
Further Details:      
 
Domain Number 46 Region: 865-993
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000653
Family Spectrin repeat 0.0085
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000011593
Domain Number - Region: 6058-6173
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000131
Family Spectrin repeat 0.0063
Further Details:      
 
Domain Number - Region: 6637-6732
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000158
Family Spectrin repeat 0.0088
Further Details:      
 
Domain Number - Region: 7747-7830
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000863
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number - Region: 4808-4921
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00396
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number - Region: 5270-5360
Classification Level Classification E-value
Superfamily Spectrin repeat 0.012
Family Spectrin repeat 0.0084
Further Details:      
 
Domain Number - Region: 682-783
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0288
Family Spectrin repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000011593   Gene: ENSTGUG00000011195   Transcript: ENSTGUT00000011718
Sequence length 8776
Comment pep:novel chromosome:taeGut3.2.4:3:56045939:56287046:1 gene:ENSTGUG00000011195 transcript:ENSTGUT00000011718 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DEQESVQKRTFTKWINTHLAKRNPPMLVNDLFEDIKDGVMLIALLEVLSGQKLPCEQGRQ
LKRIHWVANIGTALKFLEGRRIKLVNINSTDIADGRPSIVLGLVWTIILYFQIEELTSNL
PQLQPLSSSASSVESVVSSETASPPSKRKVVTKVQGSARKALLKWLQYTAAKQVGIEIKD
FGQSWRSGVAFHSVIHAIRPDLVDMEKVKGRSNRENLEEAFTIAEAELGIPRLLDPEDVD
VEKPDEKSVMTYVAQFLKYYPDPHHTVTDVPENDFIMKGGFINTFYDFLLEDRLMLRDLK
VWAEQFERDIARAQVADTSLQEKYQSFKHFRVQYEVKRKQFELATQSVRKDGKLSLDQAV
VKQAWERVTSRMLDWHIHLDKSLPAPLGTIGAWLYRAESALREEVTVQQAHEETANTIHR
KLEQHKDLLKNIDGHKKAFHEIHRTRSVNGVPVPHDQLEDMADRFNFVVSSSELHLLKME
FLELKYRLLSLLVFAESKLKSWIIKYGRRESVELLLQNYISVIENSKFFEQYEVTYQILK
RAAEMYAKANGSVEEVENVMKFMSDTTAQWRNLSVEVRSVRSMLEEVIANWDRYSSTVAG
LQAWLEDAEKMLNQPEHSKKDFFRHLPHWIQQHTAMNDAGNFLIETCDETISRDLKQQLL
LLNGRWRELFMQVKQYARADELDKMRKEYVDGVAHLTAFIDGSNAKFSVPVEVSFHDVKM
FVQDLENIKQKLPAMEAQYKAVTRTVQLVTKEVSQEEANEMLGTLTRLKEQLGKVKEYSS
ALLYECQRLLSPLEELEKQITHFYESLEKVNEIISILDPEAQPTTVLKQKAQDLVAYQEN
CKKDVSLIERNSQSILQCVASTEVLQHFHQSTFQKKVTQVQITFQNMVRKAGEWRKNIEA
NSRLMKKFEESRAELEKVIQIANCCLKEKGNPEELLRKHSEFFNQLDQRVLNAFLKACDE
LTDILPEQEQHSLQEAVRKLHRQWKDLQTEAPYHLIHLKIEVQKSKFLVTVEECKAELAR
QNKVLSRESNERMIKEHMLFFGDKGSYHLCEKRLQRMEELCQKLPVSDPVRGTLESSQRI
LKDLKSQIDSTYMKLTEHSDTWKGYKSRFSELANWISSTERELKKIKENVNDTAKYKQCK
ASVGEIRKHIHKYGENHSWLKSRLAVLTSQCPDLEAKETEDELCKLSSDFKRLLDLLAEI
ENTLGAVGDCVQYKEEVKSAIEELINNSKEVQAEAEKILDTESLLQAQQLLLHHQQRTRR
LRAKRQDVQKQISQAKQLQVEGGLPSTVRDDLQKLEGTLENMQQTMEKREEQLQVTINKW
EQFERDKETVVKYLNQASSVLERILNFSSLESLSSELDQTKELSKQTEAMAVQAENLVKN
SSEIQLGSKNKQSLQHQAKSIQEQVKKMEITLEEDIKSMEMVKNKWDHFGNNFEALSNWI
AEQEKELETLETSSSPLDIQISQIKVINKEIDGKITGISNLEEEANSFSQFVTSGERAHI
KAKLTQVKRYWEELRDHAQRLEGTITGNVSALQKYEESLEQVQQSVSEFEAKLAEPLTSC
SSAAATYAALQDCTDLCHTVEKLSNSLAFLSAGVRKVANKEKAAQKVTALQQKYEKVLES
AKEKQSLLENLLAQWQKQEKELSAFLAWLEGCEAAGKPAEQYVSADRIKLEGELQALQDL
RADIESHTSVYESLLQLNESLFPTASKQCVKTMKEKFEELDERWKALPQIVDKRISFLQS
LVAEHGQFDELLLRFSDWIKQFLAELQATSEINTADQQLAASHNKNHSLEVESKKKELQS
LKEHVEKLGSFSSPDDQQTLQGKTEDCFQIFQEASQITSQRQDALDQLRIFLELHSALSG
VLQQLRQTVEKTGNMDKAKSELLEKELHGIIKDLNKLESDAISLDGSLTKAQYHLKHSIS
GQRTSCRAMVDSLGVEMEAVQNLLGTKQSEAEALGALRRSFMERKEQLLKSIEDTEEKAD
KEGLKETTLQALQQRLRIFNQLDEELNSHQHQLQWLMDKAKQIAQKDVTLAPESDKEINR
IESLWKDTKKAIHEKKEQSCILIDLMKEYQSLKSTVMKVMDSANSASVTKSIWNDQEDVR
RTLSKHEAAKNDLSDKQKDLDIFINKGKHLLAELKRVQNCDSTALKTDMNSTVDKWLDVS
ERIDENIDRLSVSMSLWDDILKTGDELDGWCNKCISQLNEGINNFSNSQRMEVLLKDFQS
EVKNKELKLEQLSSKISELKELTHSQEPPADLQFIESDLRQKLEHAKEISETAKETLKDF
STQKIQLQKLIGQMTDWLTQVEETLLSCARNLDPESLNKLKETQKDLQLQQNNIDSTREM
LNSLCRKYHSVELEALGGTVTLLIKKYEAVNLLCSRTQSRMQESLEKHFLYSMQEFQEWF
SGVKAAVKESSDRSGDSKAIEAKLHDLQGVLDSISEGQKKLDAACKEGESLYGCLPKAVV
SHIQEQIAKSNQNFQEFLNQCLNDKKALEACASYLGNFEDQYKKLALWMHDMEERISTEA
LGENKQLVSEKKTEVQKVEKFLEELLNSRDSFDQLSQMAQTLNEESHGAGREVRLASQHL
TNYQNMVKSIKEKLRTCQLALQEHLTFEEALQSMWSWVKEVQDKLATSQSTLGSKATLER
RLTQIQEILLLKGDGEVKLNMAIGKGEQALKSSNEEGQKVIQSELQTLKDVWNDIISTSV
NWQSCLDSVISQWNDYLERKNQLEQWLENLDHKVEQPLEPQIGLKEKFAQLDHFQAIVSE
IEDHSGDLQQLIEKAVELSEKTGDDCFGDAAQEELKTQFNDITTVAKEKMRKVEDIVKDH
LLYLDAVHEFTDWLHSAKEELHRWSDASGDTPTIQKKLAKINELVESRQSGAGRLGRVEA
LGPAAKRATATSSCSVLAAEMQAQAVWRQWEESARRSQGGLRDLLSQMSLWEREFVVQGR
LDEAVQRLAGQLAAWAQGLAPADSRSTDAEVVESWRKEKETLDALVKSEQMTDEIKTQLN
DLCRFSRDLSTHSSKVSGLIKEYNSLCLQASKGCQSKEQILQQRFRTAFRDFQQWLVNAR
VTTAKCFDVPQNISEASASLQKIQEFLSESENGQQKLNLVTSKGELLCSVLPKEKAKVIQ
DKSAAAKEDWKNFITTLHQKKSALEGLKIQMKDFEATAEPLQEWLTTTEKIVQGSSSRLH
DLPSKRREQQKLQSVLEEISCHEHQLNRLKEKAQQLWEEQAVSKSFMRRVSQLSSQYLTL
SNLTKEKVSRMDRIVAEHQQFSQSVKDLQDWVADAVHMLDSYCHPTADKSVLDSRMLKLE
GLLAVKQEKEVQMKIVLTRGESVLQNTSLEGVPVIEGQLQNLKDSWASLLSACIQCKSQL
EGALSKWTSYQEDVNQFSRWMEKVEASMNASERQYAELREKTAALSKAKLLNEEVLSHNS
LLETIEVKGKGMAEHYIAQLELQDLQERYKFLKERTKEAVTKAEGLLTLHQEYQRNLKAF
EVWLEKEQEKLDCLCHLDGDAQEQEATLRDLQELQVQCAEGQALLNAAVHAREEVIPWGI
PQIEDRALESLRQDWQVYQHRLSEARSQLNATVSKLRLMQKKFQKVNDWLTNLEEKVAIR
TGRRSGRATKEMQLQQMKKWHEDITIYKDDVEEVGVLAQQMLEENLTASRMGSQATQLTS
RYQTLLLHVLEQVKFLEEEIRCMEESELSFSAYTNWYGATNKNFKNVITKFDVVNKTVME
KKVQKLEVLLSDMDIGHSLLKSAREKGERAIKYMEEHEVEQLRKEIGDHVEQLEELAGSI
RKEHMTSEKCLQLVKEFTDKYKAQTQWVMEYQAILHAPMEPKSELYEKKAQLSKYKSIQQ
TVLSQEPSIKSVIEKGEALCDLVNDVALKNNIQDLQSSYQDLCSKIKACVETLEVRVKEH
EDYNSDLQEGEKWLLHMSSRLASPDLMESNSLEIITQQLANQKAIMEEIAGFEDRLNNLK
SKGDYLISQCSEHLQAKFKQNIQSHLQGTRDSYSAICSTAQRVYQTLEHELQKHVNHQDT
LQQCQTWLSTVQSELKPTTWTAFSLADAVKQVKHFRALQEQANTYLDLLCSMCDLSDATV
KSTAADIQQTKQTIEHQIMHSQYLSQGWEEIKQLKAELWIYFQDADQQLQNLKRRQAELE
LNIAQNMVLQVKEFSQKLQSKQSALTSVTEKMNKLTRGQESPEHKEIGELSNQWLDLCLQ
AHNLLMQREEDLQRTRDYHDRMNVVEVFLEKLTKEWDNLARSDAESTNVHLEALQKLAIA
LQERIFALEDLKDQKQKMIEHLNLDDKELVKEQFSHFEQRWTQLEDLVKRKIQVSVSTLE
ELSLVHSKFQELMEWAEEQQPSVSEALKQSPPPDMAQSLLMDHLAICSELEAKQLVLKML
LKDADRVMANLGLNERQELQKTLSDAQHHVACLSDLVGQRRKHLNKALSEKTQFLMAIFE
ATNQIHQHEKKVMFPEHICLLPEDVNKQIRTCKNTQANLKAYQNEITGLWAQGRDLMKEA
TNQEKSEMLGKLQELQNVYDTVLQKCNHRLLELEKNIVSRKYFKEDLDKACHWLKQADIV
TFPEVNVMNSNTELYSQLAKYQQILEQSPEYENLLLTLQRDGQEILPSLNEVDHSYLDEK
LNSLPQQFNIVTALAKEKLYKVQEAIYARKEYASLIELTSKALTELEDQFINMDKAPAAV
SAKETVSLQQAYRDLLGEATSLAAAVDELNQKKEAFRSTGQPWQPDEMLKLATLYHKLKR
QIEQKINLLDDTIEACQEHENMCMQFEAQLETVQKEQVKVNEETLPIEEKLKIYHSLVGS
LQDSGSLLKQITEHLEALSPQVDSCAYETANHQVKVWQEKLKSLHSAIVDTVMECESRLV
QSIDFKTEICRSLEWLRWVKTELNGTLSLDLKLQNIQEEIRKVQIHQEEVQSSLRIMNAL
SNKEKERYMKAKELIPADLENTLAELAELDGEVQEAIHVRQANLNKAYSLCQRYYQVMQI
ANDWLEDAQEFLQLARNGLDVENSEENLGNHVEFFSTESQFNDNLKVLQGLVSEIEPFLQ
DTASEQLVQNVAALEEKAKGTEQEAKTQQEQLQRCASEWQEYQTSRQKVIEVMNDAEKKL
SEFSIAKAASSHEAEEKLLAHKTLVSIVNSFQEKITALEEKALQLEKISNDASKASISRS
MTAVWQRWTRLRNVAQEQEKILEDAVQEWKGFNDKIQKATIAIDQLQGRLPESSVEKASK
TELLELLDYHGSFLVEVDHQLSSLGLLKQQAISTLQDVEVKPPSQKELPIMQEIKAMQDR
CHNMQQKVKKGMKMVKQELKEREEVEAEINIVKSWIQETKEYLLSPDAEVDIQLQELQSL
FGEATTHRQAVEKLAEQQQNKYLGLYTILPSELSLHLAEVGLALVTVQDQIQTKERETQQ
IKTLNQEFEQKIQGIANELNTILSKLKKKTNDIAQAKLEQKILGDELDSCNIKLLELDAS
VQDFAEQNVPLAKQLANRIGKLTALHQQTIRQAEYRAAKLSQAASHLEEYNEMLEFILKW
TEKANILVHGSITWNSSSQLRDQFKAYQSILDESGEIHGDLEAMSERIDYLASVYCTEGM
SQQVLELGRRTEELQQVIKVQLPNLQDAAKDMKKFEIELRGLQAALEQAQATLTSPELGH
LSLKEQLSHRQHLLSEMESLKPKVQAVQDCQSALRIPEEVVTSLPMCHSALRLQEEASRL
QHTAIQQCNIMQATVVQYEQYEQEMKHLQQMIESAHREIQDKPIATSNIQELQVQISRNE
ELAQKIKGYQEQIASLNSKCKMLTMKAKHATMLLTVTEVEGLSEGMEELDSDLLPAHPTH
PSVVMMTAGRCHTLLSPVTEESGEEGTNSEISSPPACRSPSPVANTDASVNQDIAYYQAL
SAEQLQTEAAKIQPSTSATQEFYEPGLESSASAKLDDLQRSWETLKNVISEKQRTLYEAL
ERQQKYQDTLQSISTKMETTEMKLNESLEPAKSPESQMAEHQALMDEIFMLQEEISELQT
SLAQELVSEPLDAEGADQMALQSTLTVLAERMATIRMKASGKRQLLEEKLNEQLEEQRQE
QALQRYRCEADELDHWLLSTRATLDTTLLPAEEPMDMEAQLVDCQNMLVEIEQKVVALSE
LSVHNENLLMEGKAHTKDEAEQLAVKLRTLKGSLLELQRVLHDKQINIRGSLQEKEESDL
DFVSSQSPSVQEWLAQARTTRSEQQQSTLQQQKELEQELEEQKNLLRSVACRGGEILTQQ
NSTEGLSISEKPDVLSEELVLEGEKPSSEEQMKRKWESLNQEFSTKQRLLQKALEKEQLL
YSRPNRLIPGMPLFKEETHDEDKSLVSPVLVELNQAFEDVSSEAGRVEETLHLEQKLYDG
VTATSMWLDGVEEQVFVATALLPEEETETYLCKQESLDKEIKDITEEVDKNKNLFAQLFP
ESSDKRVIIEDTLDCLLRRLTLLESVVNQRCHQMKGRLQQITTFKNDLKLMFTSVADNKY
LLLQKLAEAADRPETEQIQVILQAEEGLKELDAGINELKKRIDKLQIDQSSVQELSKIQD
KYDELMMIIGSRRSDLNQNMALKRQYERALQDLADLVETGQEKMAGDQKMIVSSKEEVQS
LLEKHKEYFQGLESHMILTETLSRKMSSLALLKETQLHSEMMTRASAVLKLAHKRGVELE
YILETWMHLDEDYQELTRQLESVEGNIPPVGLVEETEHRLRDRITLFQHLRSNLTEYQPK
LYQVLDDGKRLLFSVSCSELEGQLNQLGERWLSNTSKVTKELHRLETILKHWTRYQNESN
ELTQWLQSAKERLEFWSQQSLTVPQELETVRDHLNSFLEFSKEVDTKSSQKSSVLSTGNQ
LLRLKKVDTAALRAGLSHIETQWTELLTQIPAVQEKLHQLQMDKIPSRHAITEIMSWISL
MENVIQQDEENIKNVVGQKEIQGYIQKYKGFKIDLNCKQLTVDFVNQSVLQISSQDVESK
RSDKTDFAEQLGAMNRRWQILQGLITEKIQLLESLQESWTEYENNVQSLKTWFETQEKKL
KQQQKIGDQASVQNALKDCQELEDLIRTKEKEIENVEQSGLSLVQNKKEEVSSAVMNTLQ
EINHSWANLDHMVSQLKILLQSVLDQWSIYKVAYEELNSYLTEARYSLSHFYLLTGSLEA
VKVQVDKLQSLQDELEKQENSLRKFGSVTNELLKECHPPVTETLTNTLKEVNMRWNNLLQ
EVAERLRASRALLQLWQRYKDCYQQCSSTVHQREEQTNELLKTAISKDIADDEVTSWIRD
CNDVLTDLKTAQESLVVLQELGEELKSQVEASAAAAIQSDHLSLNQNLSALEQALRKQQA
ALQAGVLDYQTFAKNLEVLETWITEAEETLKEQDPSPSSDVSTIQSRMEQLKSQMLKFSS
MAPDLDRLNELGYRLPLNDKEIKRMQNLNRHWSLISPQTTERFSKLQSFLLQQQTFLEKC
GTWMDLLVQTEQKLAVEVSGNYQRLLEQQREHEASIHLFQAEMFSRQQILHSIISDGQHL
LEQGQVDDRDEFNLNLTLLSNQWQGVIRRAQQMRGIIDSRIQQWQRYREMAEKLRKWLLE
MSCQPVTELGSAPIPLQQARVLLDEVQLKEKVLLRQQGSYILTVEAGKQLLLSADSGAEA
VLQSELTEIQERWKIVSTQLEQQKKQLALLLKDWEKCEKGIGDSLEKLRSFKKKLSQPLP
DHHDELHAEQIRCKELENAVEGWTDDLAHLSLLKETLSVYISADDISILSERIELLHRQW
EELCHQATVSLRRQQVSERLNEWAVFSEKNKELCEWLTQMESKVSQNGDILIEEMIEKLK
KDYQEEIAAAQKNKIQLQQMGERLAKASHESKASEIEYKLGKINDRWQHLLDLIAARVKK
LKETLVAVQQLDKNMSSLRSWLAHIESELSKPIVYETCDSEEIQRKLNEQQELQRDIEKH
STGVASVLNLCEVLLHDCDACATEAECDSIQQATRNLDRKWRNICAMSMERRLKIEETWR
LWQKFLDDYSRFEEWLKTSERTAAFPSSSGVLYTVAKEELKKFEAFQRQVHESLTQLELI
NKQYRRLARENRTDSNGSLKQMVHEGNQRWDNLQKRVTSILRRLKHFIGQREEFETARDS
ILVWLTEMDLQLTNIEHFSECDVQAKIKQLKAFQQEISLNNNKIEQIIVQGEQLIEKSEP
LDAAVIEEELDELRRYCQEVFGRVERYHKKLIRLPLTDDEHDLSDREVDLDESADLSDIR
WHDKSADSILSPHPSSNLSLPLSQPLRSERSGRDTPASVDSIPLEWDHDYDLSRDLETAV
SRALHSEEDRGQEKDFYLRGAAGITGEPGALEAHIRQLDKALDTSRFQIQQTENIIRSKT
PTGPELDSTYKGYMKLLGECSGSIDSVRRLGYKLKEEEEKFSGLINMNSTETQTAGVIER
WELIQAQALSKELRMKQNLQQWQQFNSDLNSIWAWLGETEEELEKLHRLDLSTDIQTIEL
RIKKLKELQKAIDNRKAIILSINLCSSEFTQSDSEESKKLQERLSQMNVRWEHVCSMIED
WRSSLQDALIQCQDFHELSHGLLLWLENIDRRKNEIVPINPNLDSEILQDHHRLLMQIRR
ELLESQLKVASLQDMSCQLLVNAEGKDCLEAKEKVHVIGNRLKLLLKEVTRHIKDLEKIL
DISSSQLELSSWSSDELDTSGSVSPVSGRSTPSRQRTPRGKCSLSQPGPSVSSPHSRSTR
GGSGSSPSEAGPVWRCPSFFLRVLRAALPLQLLLLLLIGLACLVPMTEEDYSCAMANNFA
RSFHPMLKYMNGPPPL
Download sequence
Identical sequences H0ZLX0
59729.ENSTGUP00000011593 ENSTGUP00000011593 ENSTGUP00000011593

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]