SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000011839 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000011839
Domain Number 1 Region: 1-214
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.83e-81
Family Calponin-homology domain, CH-domain 0.0000196
Further Details:      
 
Domain Number 2 Region: 232-354
Classification Level Classification E-value
Superfamily Spectrin repeat 9.6e-35
Family Spectrin repeat 0.000000549
Further Details:      
 
Domain Number 3 Region: 468-589
Classification Level Classification E-value
Superfamily Spectrin repeat 3.4e-31
Family Spectrin repeat 0.0000035
Further Details:      
 
Domain Number 4 Region: 355-463
Classification Level Classification E-value
Superfamily Spectrin repeat 2.75e-27
Family Spectrin repeat 0.00000285
Further Details:      
 
Domain Number 5 Region: 592-704
Classification Level Classification E-value
Superfamily Spectrin repeat 3.45e-22
Family Spectrin repeat 0.00000221
Further Details:      
 
Domain Number 6 Region: 703-829
Classification Level Classification E-value
Superfamily EF-hand 1.54e-21
Family EF-hand modules in multidomain proteins 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000011839   Gene: ENSTGUG00000011477   Transcript: ENSTGUT00000011968
Sequence length 857
Comment pep:novel chromosome:taeGut3.2.4:5:27576356:27621557:1 gene:ENSTGUG00000011477 transcript:ENSTGUT00000011968 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TFTAWCNSHLRKAGTQIENIEEDFRDGLKLMLLLEVISGERLAKPERGKMRVHKISNVNK
ALDFIASKGVKLVSIGAEEIVDGNVKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQ
RKTAPYKNVNIQNFHISWKDGLGFCALIHRHRPELIDYGKLRKDDPLTNLNTAFDVAEKY
LDIPKMLDAEDIVGTARPDEKAIMTYVSSFYHAFSGAQKAETAANRICKVLAVNQENEQL
MEDYEKLASDLLEWIRRTIPWLENRAPENTMQAMQQKLEDFRDYRRLHKPPKVQEKCQLE
INFNTLQTKLRLSNRPAFMPSEGKMVSDINNAWGGLEQAEKGYEEWLLNEIRRLERLDHL
AEKFRQKASIHESWTDGKEAMLQQKDYETATLSEIKALLKKHEAFESDLAAHQDRVEQIA
AIAQELNELDYYDSPSVNARCQKICDQWDNLGALTQKRREALERTEKLLETIDQLYLEYA
KRAAPFNNWMEGAMEDLQDTFIVHTIEEIQGLTTAHEQFKATLPDADKERQAILGIHNEV
SKIVQTYHVNMAGTNPYTTITPHEINGKWEHVRQLVPRRDQALMEEHARQQQNERLRKQF
GAQANVIGPWIQTKMEEIGRISIEMHGTLEDQLNHLRQYEKSIVNYKPKIDQLEGDHQLI
QEALIFDNKHTNYTMEHIRVGWEQLLTTIARTINEVENQILTRDAKGISQEQMNEFRASF
NHFDRDHSGTLGPEEFKACLISLGYDIGNDAQGEAEFARIMSIVDPNRLGVVTFQAFIDF
MSRETADTDTADQVMASFKILAGDKNYITVDELRRELPPDQAEYCIARMAPYNGRDAVPG
ALDYMSFSTALYGESDL
Download sequence
Identical sequences H0ZML6
ENSTGUP00000011839 59729.ENSTGUP00000011839 ENSTGUP00000011839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]