SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000011929 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000011929
Domain Number 1 Region: 49-226
Classification Level Classification E-value
Superfamily PR-1-like 6.02e-54
Family PR-1-like 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000011929   Gene: ENSTGUG00000011576   Transcript: ENSTGUT00000012060
Sequence length 258
Comment pep:novel chromosome:taeGut3.2.4:2:124746101:124766258:1 gene:ENSTGUG00000011576 transcript:ENSTGUT00000012060 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTVIAAISCSLLFSVLCETSALVLPNSTDLFLSDNNFTDIKTALAAHLDSAKIPKARRKR
YISQNDMIAILDYHNQVRGKVFPPASNMEYMVWDETLAKSAEAWAATCIWDHGPSYLLRF
LGQNLSVRTGRYRSILQLVKPWYDEVKDYAFPYPQDCNPRCPMRCYGPMCTHYTQMVWAT
SNRIGCAIHTCHNMNVWGSVWRRAVYLVCNYAPKGNWIGEAPYKVGVPCSACPPSYGGSC
IDNLCFPGVTSNYLYWFK
Download sequence
Identical sequences H0ZMV5
ENSTGUP00000011929 XP_002199413.1.42559 XP_021386284.1.53032 59729.ENSTGUP00000011929 ENSTGUP00000011929

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]