SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000011936 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000011936
Domain Number 1 Region: 54-221
Classification Level Classification E-value
Superfamily PR-1-like 1.83e-52
Family PR-1-like 0.00011
Further Details:      
 
Domain Number 2 Region: 293-391
Classification Level Classification E-value
Superfamily LCCL domain 5.62e-31
Family LCCL domain 0.0012
Further Details:      
 
Domain Number 3 Region: 395-499
Classification Level Classification E-value
Superfamily LCCL domain 1.83e-28
Family LCCL domain 0.00099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000011936   Gene: ENSTGUG00000011579   Transcript: ENSTGUT00000012067
Sequence length 504
Comment pep:novel chromosome:taeGut3.2.4:2:124847794:124883556:1 gene:ENSTGUG00000011579 transcript:ENSTGUT00000012067 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKYVVQEWLRVTTLLFIAQAVSAMVLPNATLLEELLEKYMDEDGEWWIAKQRGKRAITDS
DMQSILDLHNKLRGQVYPPASNMEYMTWDTELERSAESWAETCLWEHGPASLLPSIGQNL
GAHWGRYRPPTFHVQAWYDEVKDFTYPHPHECNPYCPYRCSGPVCTHYTQVVWATSSRIG
CAINLCHNMNIWGQIWPKAVYLVCNYSPKGNWWGHAPYKSGRPCSACPPSFGGGCRENLC
YREDSERPYSPHEPEEETNEIERQRSKAQDATPSASTGTDDNEKNEVISTQQMSQIVSCE
VRLRDQCKGTTCNRYECPAGCLDSKAKVIGSVHYEMQSSICKAAIHYGILDNEGGWVDVT
RQGRKNYFIKSYRNGVQSIGKYQSANSFTVSKVTVQAITCETTVEQLCPFQKPASHCPRV
YCPHNCMQANPHYARVIGTRIYSDISSICRAAVHAGVVRNQGGYVDVMPVDKRKVYVASF
QNGIYSESLQNPPGSKAFRVFAVV
Download sequence
Identical sequences H0ZMW2
59729.ENSTGUP00000011936 ENSTGUP00000011936 ENSTGUP00000011936

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]