SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000012338 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000012338
Domain Number 1 Region: 35-165,211-319
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 6.68e-34
Family Calponin-homology domain, CH-domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000012338   Gene: ENSTGUG00000011975   Transcript: ENSTGUT00000012475
Sequence length 320
Comment pep:novel chromosome:taeGut3.2.4:1A:63951285:63972225:-1 gene:ENSTGUG00000011975 transcript:ENSTGUT00000012475 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNPDFLNAFTEPSTLDRFLTEDVLAKATGEKRKLIKPTSSSNPKLEELKLFLTDWINRTL
KQEHIVVKSLEEDLYDGLVLHHLLENLGSLKLDVEKIALTEKKQRQKLSVILEVVAKCLQ
LEESQLKWSVESILAKDLLSTLHLLVAIAKHFEPTLALPPNVQVETITIETTSGGLKTSN
AVEYITENKENIGTQSKDDAFDELFNCAPDKLDAVKKALLQFVDQHVGKLGLNVKDIESQ
FSDGVILLLLTGQLEGYFLNLRNFFLTPASTMEMLHNVNLALELLAEGGLLNFPVNSEDI
VNGDTKAIMRVLYSLYSKYR
Download sequence
Identical sequences H0ZP09
ENSTGUP00000012338 59729.ENSTGUP00000012338 ENSTGUP00000012338

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]