SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000012363 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000012363
Domain Number 1 Region: 17-112
Classification Level Classification E-value
Superfamily C-type lectin-like 6.77e-36
Family Link domain 0.00000464
Further Details:      
 
Domain Number 2 Region: 115-186
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.75e-23
Family Spermadhesin, CUB domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000012363   Gene: ENSTGUG00000012000   Transcript: ENSTGUT00000012500
Sequence length 190
Comment pep:novel chromosome:taeGut3.2.4:7:38330492:38356171:1 gene:ENSTGUG00000012000 transcript:ENSTGUT00000012500 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FRDGVLHNSIWLERAAGVYHRESRSGKYRLTFAEARAVCEYEGGRLATLQQLEAARKIGF
HVCAAGWMAKGRVGYPIVKAGANCGFGKTGIVDYGIRLNRSERWDAYCYNPNGKECGGVF
TDSKHVFKSPGYPKEYENEQVCYWHIRVSYGHRIHLQFLEFDLEEDTACLADFLEVYDSY
DDVNGFVGRY
Download sequence
Identical sequences H0ZP34
ENSTGUP00000012363 ENSTGUP00000012363 59729.ENSTGUP00000012363

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]