SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000012642 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000012642
Domain Number 1 Region: 2-198
Classification Level Classification E-value
Superfamily L domain-like 1.7e-38
Family Ngr ectodomain-like 0.072
Further Details:      
 
Domain Number 2 Region: 508-617
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.14e-27
Family Calponin-homology domain, CH-domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000012642   Gene: ENSTGUG00000012267   Transcript: ENSTGUT00000012783
Sequence length 657
Comment pep:novel chromosome:taeGut3.2.4:1:57069023:57136314:-1 gene:ENSTGUG00000012267 transcript:ENSTGUT00000012783 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SDLSKNRLTEVPTELCHFVSLETLNLYHNCIKVIPDAIVNLQMLTYLNLSRNQLSSLPAC
LCGLPLKVLIASNNKLGSLPEEIGQLKQLMELDVSCNEITALPQQIGQLKSLKELNVRRN
YLEVLPQELVQLPLVKFDFSCNKVLVIPICFRKMVQLQVLLLENNPLQSPPAQICTKGKV
HIFKYLTVQACQIKTADSLYLNAIEPQHLPQPVEESKKDSDSGVGSDNGDKRLSATEPSD
EDTISFNVPMSDIVEEDHIIKDDSSHHASSRKVEFHQGSSHIFVNDKSRETENQFDEPDT
LTTEFMSYIKATAECDELLRIEEDTQWQADEIINLSEEQNIDIAMIEQLREAVDLLQDSN
RLSMDISDSSVVNMYPTEPAMVLEFHESTVNGQIQMDMSSLDIVCSSVNFAFCMVRYAEI
HSGDKSPAMSPTTNTTIPFGLKPRSDPSLSFPPISFNTLTQAQTWDNFSYSIPSEGDSDN
VFLRPQRNLESIDPQFTIRRKMEQMREERELVEQLRENIETRLKICLPEDLGSALMDGVV
LCHLVNHVRPRSVGSIHVPSPAVPKLSMAKCRRNVENFLDACRKLGIPEADLCSPYDILQ
SDIRHIRKTVDTLLALGEKPPQSTSTFRSWDLIGFCLFHILFIVLMYITYHWNLLTA
Download sequence
Identical sequences H0ZPV9
59729.ENSTGUP00000012642 ENSTGUP00000012642 ENSTGUP00000012642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]