SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000012655 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000012655
Domain Number 1 Region: 117-619
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.63e-162
Family Calponin-homology domain, CH-domain 0.0000000023
Further Details:      
 
Domain Number 2 Region: 6-139
Classification Level Classification E-value
Superfamily EF-hand 5.59e-18
Family Calmodulin-like 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000012655   Gene: ENSTGUG00000012284   Transcript: ENSTGUT00000012796
Sequence length 626
Comment pep:novel chromosome:taeGut3.2.4:1:57345470:57371431:1 gene:ENSTGUG00000012284 transcript:ENSTGUT00000012796 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VRMASTAHFSEEEMAELREAFSKVDISGNGFIDTSDLTEVLKAANLPLPGYKARELIQSL
TTTGNGRISFDEFISIFQDLKSDDVAKSFRKQINKKEGICAIGGTSEQSSAGTQHSYSEE
EKYAFVNWINKALEKDPDCKHVVPMNPETDDLFQAVGDGIVLCKMINFSVPDTIDERTIN
KKKLTPFTIQENLNLALNSASAIGCHVVNIGAEDLKEGKPYLVLGLLWQVIKIGLFADIE
ISRNEALIALLREGESLEDLMKLSPEDLLLRWANYHLENAGCNKVNNFSSDIKDSRAYYH
LLNQVAPKGDEEGIPAITIDMSGLREKDDVQRAECMLQQAERLGCRQFVTATDVVRGNPK
LNLAFIANLFNKYPALHKPENQDIDWSSIEGETREERTFRNWMNSLGVNPRVNHLYSDLS
DALVIFQLYEKIKVPVDWNRVNKPPYPKLGGNMKKLENCNYAVELGKNQAKFSLVGIAGQ
DLNEGNRTLTLALIWQLMRRYTLNILEDIGGGEKVNDEIIVSWVNETLTAAGKDSTISSF
KDSKISTSMPVLDLIDAIQPGSIKYDLLKTEDLNDEEKLNNAKYAISMARKIGARVYALP
EDLVEVKPKMVMTVFACLMGKGMKKV
Download sequence
Identical sequences H0ZPX2
ENSTGUP00000012655 ENSTGUP00000012655 59729.ENSTGUP00000012655

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]