SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000012867 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000012867
Domain Number 1 Region: 389-624
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.83e-38
Family Calponin-homology domain, CH-domain 0.0001
Further Details:      
 
Domain Number 2 Region: 87-241,386-469
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.28e-20
Family FAD/NAD-linked reductases, N-terminal and central domains 0.078
Further Details:      
 
Domain Number 3 Region: 786-819
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000101
Family LIM domain 0.013
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000012867
Domain Number - Region: 820-848
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000238
Family LIM domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000012867   Gene: ENSTGUG00000012499   Transcript: ENSTGUT00000013014
Sequence length 966
Comment pep:novel chromosome:taeGut3.2.4:1A:70210553:70275388:1 gene:ENSTGUG00000012499 transcript:ENSTGUT00000013014 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEESKNEKVNQAHVLFDRFVQASTCKGTLKAFQELCDYLELKPKDYRSFYHKLKSKLNYW
KAKALWAKLDKRGSHKDYKKGKACANTKCLIIGAGPCGLRTAIDLSFLGAKVVVIEKRDA
FSRNNVLHLWPFTIHDLRGLGAKKFYGKFCAGSIDHISIRQLQLILLKVALILGIEIHVN
VEFRGLVYPPEDQENESKSWRALVHPKTHPVSEYEFEVIIGGDGRRNTLEGFRRKEFRGK
LAIAITANFINRNTTAEAKVEEISGVAFIFNQKFFQDLRDATGIDLENIVYYKDDTHYFV
MTAKKQSLLDKGVIRHDHADTEVLLSRENVDQEALLNYAREAADFSTNQQLPSLDFAINH
YGQPDVAMFDFTCMYASENAALVREQNGHQLLVALVGDSLLEPFWPMGTGIARGFLAAMD
SAWMVRSWSLGASPLEVLAERESIYRLLPQTTPENVSKNFSHYSIDPATRYPNINVNFLR
PQQVRHLYNTGDLKDIHLEIENFVNSRTPKLTRNESVARSSKLLSWCQRQTDGYAGVNVT
DLTMSWKSGLALCAIIHRYRPDLIDFDSLDEHDVEKNNQLAFDIAEKEFGISPIMTGKEM
ASVGEPDKLSMVMYLTQFYEMFKDTIPSTDSLELNAEEKAALIASTKSPISFLSKLGQSI
SRKRTPKDKKEKELDGAGKRRKTSQSEDEDLPRSYREERPTLVSALTERRIDAAIGNQNK
VKSMATQLLAKFEENAPVPSSNLRRQQPVLPYQERVHSQPSSRREQGRLAPIPQWKQGSL
KKEFPQNLGGSDVCYFCRKRVYVMERLSAEGKFFHRSCFKCEYCATTLRLSSYAYDIEDG
KFYCKPHYCYRVSGYAQRKRPAVGPLSGKDTKGPLQDAMASDGSGRANSIPASAERAPGP
SVNGLEEPSLAKRLRGTPERIELENYRLSLQREEELEEVPEETLAEHNLSSVLDKGTEED
VPSRSA
Download sequence
Identical sequences H0ZQH8
ENSTGUP00000012867 ENSTGUP00000012867 59729.ENSTGUP00000012867

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]